KEGG   Bacillus subtilis subsp. subtilis 168: BSU28570Help
Entry
BSU28570          CDS       T00010                                 

Gene name
yshE
Definition
(RefSeq) hypothetical protein
  KO
K08989  putative membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU28570 (yshE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF350 NnrS DUF5367 CrgA TRAP-gamma MerC
Motif
Other DBs
NCBI-GeneID: 937969
NCBI-ProteinID: NP_390735
Pasteur: BG12329
BSORF: BG12329
UniProt: P94546
Position
complement(2920517..2920921)
Genome map
AA seq 134 aa AA seqDB search
MSDFWENELVEIAAYYSVAVLCLVLFLTVFELVTAYKNWEEIQKGNLAVAMATGGKILGI
ANVFQHSISQHNSLLQMIGWGVYGFVMLLISYFIFEFLTPRFKIDQEIENDNRAVGFISF
VISVGLSFVVAAGI
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttttgggaaaacgagcttgtggaaatcgcggcatattacagtgtcgcggtt
ctctgcctcgtcctctttttgactgtgtttgagctggtgacggcttataaaaactgggaa
gagattcaaaaaggaaatcttgcggtggcaatggcgaccggcggaaaaattttgggaatc
gcaaacgtatttcagcattccatctcccagcataattcgctgctgcaaatgatcggctgg
ggcgtttacgggtttgttatgcttctgatcagctactttatttttgagtttttgactccg
cggtttaaaattgatcaggaaatcgaaaatgataaccgggctgtcggctttatttcattt
gtcatttctgtcgggctttcttttgtggtggcagccggaatataa

DBGET integrated database retrieval system