KEGG   Bacillus subtilis subsp. subtilis 168: BSU28590Help
Entry
BSU28590          CDS       T00010                                 

Gene name
yshC
Definition
(RefSeq) DNA polymerase/3'-5' exonuclease PolX
  KO
K02347  DNA polymerase (family X)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU28590 (yshC)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA polymerase
    BSU28590 (yshC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_8 DNA_pol_B_thumb PHP HHH_5 RNase_P_p30 DNA_pol_B_palm L-fibroin
Motif
Other DBs
NCBI-GeneID: 937426
NCBI-ProteinID: NP_390737
Pasteur: BG12327
BSORF: BG12327
UniProt: P94544
Position
complement(2923314..2925026)
Genome map
AA seq 570 aa AA seqDB search
MHKKDIIRLLETIAVYMELKGDNPFKVSAFRKAAAALEQDDRSLSEMDDMMSLSGIGKGT
YSVIKEYIDEGKSSTLESLQKEVPEGLVPLLKLPGLGGKKIAKLYKELGVHDAESLKEAC
EQQKVQGLAGFGKKSEEKILQALGEAGKQPERFPIGYALRIAREIEEHLSQFTHIIKFSR
AGSLRRARETVKDLDYIIATDHPAEVREQLLELPNIKSVIASGDTKVSVILSFEYETSVD
FRLVTEEQFPTTLHHFTGSKDHNIKMRQIAKERGERISEYGVETVETGEIKTFPSEREFY
AHFGLPLIPPEIRESGQEVETYSDSIELIELGQIKGDLHMHSTWSDGAFSIREMAEACIK
KGYQYMAITDHSQYLKVANGLTAERLKQQAKEIDALNAEFENFRILKGVEMDILPDGTLD
YDDDVLAEMDIVIASIHSSFNQPEHVIMKRLETALTNKHVDIIAHPTGRLIGRRAGYEID
IDQLIELARKTNTALELNANPARLDLRTEHLMKANEQGVTLVINTDAHNIEMLDDMKTGV
TAARKGWTETKNVLNARSLKDVEAFLKRND
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaaaagatattatccggctgcttgaaaccattgcagtctatatggaactcaaa
ggggacaacccgtttaaagtatccgccttccgaaaagcggcggcagctctggaacaggac
gaccgaagcttatcagaaatggacgatatgatgtcgctgtccggcattggaaaaggaacg
tacagcgtcattaaagagtatatagatgaaggaaagtcaagcacgctcgaatcgcttcag
aaagaagtgccggaaggactcgtgcctttattgaagctgccggggctcggcggcaaaaaa
atcgcaaagctgtataaagagctcggcgtacacgatgcagaatctctgaaggaagcctgt
gagcagcaaaaggtccagggtcttgcgggcttcggcaaaaaatcggaagaaaaaatatta
caggcgctcggggaagccggaaaacagcctgaacggttcccgatcggctacgccctccgg
atcgcgcgggaaattgaggagcatctttctcaatttacgcatatcatcaaattttctcgt
gccggaagtctccgcagagcgcgggaaacggtgaaggatctggattatatcattgctaca
gatcatccggctgaagtaagagagcagcttcttgagctgccaaacatcaaaagcgtgatc
gcaagcggagatacgaaggtgtccgtcatcctttcctttgaatatgaaacaagcgtcgat
ttccgtcttgtgacggaagagcagtttccgacaacactccatcattttacgggatcaaag
gatcacaatattaagatgcgccaaatcgccaaagaacgcggcgagcggatcagtgaatac
ggcgttgagacagttgaaaccggagagatcaaaacatttccgagtgaacgtgaattttat
gcgcacttcggcctgccgctgattccgccggaaattcgtgaaagcggacaggaagtggaa
acctacagcgacagcattgaactgatagagctcgggcaaatcaaaggtgatctccacatg
cactcaacgtggagcgatggcgcattttcgatcagagagatggctgaagcctgcatcaaa
aaaggctatcaatacatggcgatcaccgatcactcacaatatttaaaggtcgccaacggg
cttactgcagaaagacttaagcagcaggcaaaagaaattgacgcgctgaatgcagagttt
gaaaacttccgtattttgaaaggcgttgagatggatatcctgcctgacggtacgctcgat
tatgatgacgatgtgcttgcggaaatggatatcgttattgcatcgattcattccagtttt
aatcagccggaacacgtgattatgaaacggcttgagacggcactgacaaacaagcatgtt
gacattatcgcacacccgaccgggcgccttatcggcagacgggccggttacgaaatcgat
attgatcagctgattgagcttgcgaggaaaacaaatacggcgcttgaactcaatgccaac
cctgcgcgccttgatctgcgcacagagcatttaatgaaagcaaacgaacaaggggttaca
ttggtgattaatactgatgcccataatattgagatgttagacgatatgaaaactggcgtt
actgccgcgcgcaaaggatggacggaaacgaaaaacgttctgaatgcccggtcgcttaaa
gacgtagaggcatttctgaagcgcaacgattaa

DBGET integrated database retrieval system