KEGG   Bacillus subtilis subsp. subtilis 168: BSU28600
Entry
BSU28600          CDS       T00010                                 

Gene name
yshB
Definition
(RefSeq) transmembrane protein YshB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Colicin_V CAAD DUF3935
Other DBs
NCBI-GeneID: 937446
NCBI-ProteinID: NP_390738
Pasteur: BG12326
BSORF: BG12326
UniProt: P94543 A0A6M3ZI55
Position
complement(2925100..2925633)
AA seq 177 aa
MLDIIILILLLMGTLLGLKRGFILQFIRLTSFILSIAFAALFYKNVAPHLHWIPAPDFSA
GQPALSFFTGNLEAAYYNAIAFIVLFIIAKILLRIIGSFLSIVAGIPVIKQINQMLGAVL
GFLEVYLFTFVLLYVASVLPVDALQQMMGQSSLANVIINHTPYLSGLLQELWTQYGA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgctagatatcatcatcttaatcttgctcctgatggggactttactggggttaaaacgc
ggttttatcctgcagtttatccgcttgacgagctttattttatcaattgcctttgcggct
ttattctataaaaacgtggcaccgcatttacattggattcccgcacccgatttttcagcg
ggacagccggctctttctttttttacggggaatttggaagcagcgtactataatgcgatt
gcgtttatcgttttatttatcattgctaaaatcttactgagaatcatcggctcgttcctg
agtattgtagccggcattccggtgattaaacaaatcaaccagatgctgggagccgttctc
ggttttctagaagtctatttatttacatttgtgctgctgtatgtcgcatccgttctgccg
gtagacgcgttgcagcaaatgatggggcaatcgtctctcgcaaatgtgatcattaaccat
acaccgtacttgtcagggcttttacaagagctgtggacacagtacggggcataa

DBGET integrated database retrieval system