KEGG   Bacillus subtilis subsp. subtilis 168: BSU28610
Entry
BSU28610          CDS       T00010                                 
Symbol
yshA
Name
(RefSeq) cell division protein ZapA
  KO
K09888  cell division protein ZapA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU28610 (yshA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU28610 (yshA)
SSDB
Motif
Pfam: ZapA
Other DBs
NCBI-GeneID: 937442
NCBI-ProteinID: NP_390739
Pasteur: BG12325
BSORF: BG12325
UniProt: P94542 A0A6M4JLR1
Position
complement(2925640..2925897)
AA seq 85 aa
MSDGKKTKTTVDIYGQHFTIVGEESRAHMRYVAGIVDDKMREINEKNPYLDINKLAVLTA
VNVVHDYVKLQEKCEKLERQLKEKD
NT seq 258 nt   +upstreamnt  +downstreamnt
ttgtctgacggcaaaaaaacaaaaacaaccgttgacatttacggccagcacttcacgatt
gtcggtgaagaaagcagagcccatatgaggtatgtcgccggaattgttgatgataaaatg
agagaaatcaatgaaaaaaatccataccttgatataaataaacttgcagtgctgacagcg
gtaaatgtggtgcacgattatgtcaaattacaagagaaatgtgaaaaactggagcgtcag
cttaaagaaaaggattga

DBGET integrated database retrieval system