KEGG   Bacillus subtilis subsp. subtilis 168: BSU28610Help
Entry
BSU28610          CDS       T00010                                 

Gene name
yshA
Definition
(RefSeq) cell division protein ZapA
  KO
K09888  cell division protein ZapA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU28610 (yshA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU28610 (yshA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZapA
Motif
Other DBs
NCBI-GeneID: 937442
NCBI-ProteinID: NP_390739
Pasteur: BG12325
BSORF: BG12325
UniProt: P94542
Position
complement(2925640..2925897)
Genome map
AA seq 85 aa AA seqDB search
MSDGKKTKTTVDIYGQHFTIVGEESRAHMRYVAGIVDDKMREINEKNPYLDINKLAVLTA
VNVVHDYVKLQEKCEKLERQLKEKD
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgacggcaaaaaaacaaaaacaaccgttgacatttacggccagcacttcacgatt
gtcggtgaagaaagcagagcccatatgaggtatgtcgccggaattgttgatgataaaatg
agagaaatcaatgaaaaaaatccataccttgatataaataaacttgcagtgctgacagcg
gtaaatgtggtgcacgattatgtcaaattacaagagaaatgtgaaaaactggagcgtcag
cttaaagaaaaggattga

DBGET integrated database retrieval system