KEGG   Bacillus subtilis subsp. subtilis 168: BSU28620Help
Entry
BSU28620          CDS       T00010                                 

Gene name
rnhC
Definition
(RefSeq) ribonuclease HIII
  KO
K03471  ribonuclease HIII [EC:3.1.26.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU28620 (rnhC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU28620 (rnhC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     BSU28620 (rnhC)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     BSU28620 (rnhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII DUF3378 LEF-4
Motif
Other DBs
NCBI-GeneID: 937436
NCBI-ProteinID: NP_390740
Pasteur: BG12324
BSORF: BG12324
UniProt: P94541
Position
2926031..2926972
Genome map
AA seq 313 aa AA seqDB search
MSHSVIKVSLSAIDQMKMTYSGSLTASVPQGAVFQAKPPGCTITAYQSGKVLFQGKNAAA
ESARWGTAEPQEKKKTAKKPADPRYAPPADIAGMSVIGSDEVGTGDYFGPMTVVCAYVDK
TMLPLMKELGVKDSKDLKDPQIIEIARNLIKTIPYSLLVLKNEKYNSMQEKGMSQGKMKA
LLHNQAITHLLRKLDGVKPEAILIDQFAEPGVYFNHLKGRDIVKERTYFSTKAEGIHLAV
AAASIIARYSFLMEMDKLSRAAGMTLPKGAGPHVDEAAAKLILKKGASALRTFTKLHFAN
TQKAQRLADKKRS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccattcagtgataaaagtatcgttgtctgctattgaccaaatgaaaatgacgtac
agcggttcacttacagcctctgttccgcagggagccgtttttcaggcaaaaccgcccggc
tgtaccattacagcatatcaatcaggtaaggtcttgtttcaaggaaaaaacgctgcggca
gaatccgcgcgctggggaacagcagagcctcaggaaaagaagaaaacggccaaaaagccg
gctgatccccgctatgcccctccggcagatatcgccggaatgtctgttatcggttctgac
gaagtcggaaccggagattactttggcccaatgacggttgtatgcgcgtacgtcgacaaa
accatgcttcctttaatgaaggaactcggtgttaaggattctaaagatttaaaagatccg
caaatcatcgagattgcccgaaacctgattaaaaccattccgtacagcctgctggtgtta
aagaatgaaaagtataacagcatgcaggaaaaaggcatgagccaagggaaaatgaaagct
ttgctgcacaatcaggcgatcacacatttattaagaaaattggatggagtaaagcctgaa
gccattttgattgaccaattcgctgagccaggcgtctacttcaatcatttaaagggcaga
gacattgtgaaggagcggacctattttagcacaaaagctgaaggtattcacctggctgtc
gccgctgcttcaatcattgcaagatattcatttttaatggaaatggataaactatcacgc
gcggcaggaatgacgcttccaaaaggggccggtccgcacgtcgatgaagcggccgccaag
ctgatcctcaaaaaaggggcatctgcactcagaacctttacaaaactccatttcgccaat
acgcaaaaagcgcagcgccttgctgataaaaaacgttcatag

DBGET integrated database retrieval system