KEGG   Bacillus subtilis subsp. subtilis 168: BSU28650
Entry
BSU28650          CDS       T00010                                 

Symbol
ysgA
Name
(RefSeq) tRNA/rRNA methyltransferase YsgA
  KO
K03437  RNA methyltransferase, TrmH family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU28650 (ysgA)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    BSU28650 (ysgA)
SSDB
Motif
Pfam: SpoU_methylase SpoU_sub_bind Lactamase_B_2
Other DBs
NCBI-GeneID: 937444
NCBI-ProteinID: NP_390743
Pasteur: BG12323
BSORF: BG12323
UniProt: P94538 A0A6M4JK67
Position
complement(2930827..2931573)
AA seq 248 aa
MKQIESAKNQKVKDWKKLHTKKERTKTNTFLIEGEHLVEEALKSPGIVKEILVKDETRIP
SDLETGIQCYMLSEDAFSAVTETETPQQIAAVCHMPEEKLATARKVLLIDAVQDPGNLGT
MIRTADAAGLDAVVLGDGTADAFNGKTLRSAQGSHFHIPVVRRNLPSYVDELKAEGVKVY
GTALQNGAPYQEIPQSESFALIVGNEGAGVDAALLEKTDLNLYVPLYGQAESLNVAVAAA
ILVYHLRG
NT seq 747 nt   +upstreamnt  +downstreamnt
gtgaaacaaatagaatcggcaaaaaaccaaaaagtgaaggattggaaaaagcttcacaca
aaaaaagaacgaacaaaaacaaatacatttctgatagagggagaacacctcgttgaagag
gcgttgaaaagcccgggcattgtgaaagaaatccttgtaaaggatgaaacgaggattcct
tcagatcttgagactggtatccagtgctatatgctgagtgaagatgcgttttcagctgtg
actgaaaccgaaacgccgcagcagattgccgctgtgtgccatatgcctgaagaaaagctg
gcaacggcacgcaaggtgctgctgattgacgctgttcaagatccgggaaaccttggcaca
atgattcgaacggctgatgcggccggtttggatgcggttgtactcggtgacggcacggcg
gacgcctttaacggaaaaacactgcgatctgctcaaggatctcacttccatattcctgtt
gtgagaagaaacctgccttcatatgtggacgaattgaaggcagagggcgtaaaagtatac
ggcacggcgctgcaaaacggagcgccttaccaggagattcctcagtctgaatcctttgcg
ctcattgtaggaaatgaaggtgcaggggtagatgctgcattgctggaaaaaacggatttg
aacctgtacgtgccgctttacggacaggctgaatcactaaacgttgcggttgcggctgcc
atcctcgtgtatcacttgcgaggatag

DBGET integrated database retrieval system