KEGG   Bacillus subtilis subsp. subtilis 168: BSU28660Help
Entry
BSU28660          CDS       T00010                                 

Gene name
sspI
Definition
(RefSeq) small acid-soluble spore protein I
  KO
K06426  small acid-soluble spore protein I (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU28660 (sspI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSPI
Motif
Other DBs
NCBI-GeneID: 937579
NCBI-ProteinID: NP_390744
Pasteur: BG12318
BSORF: BG12318
UniProt: P94537
Position
2931692..2931907
Genome map
AA seq 71 aa AA seqDB search
MDLNLRHAVIANVTGNNQEQLEHTIVDAIQSGEEKMLPGLGVLFEVIWQHASESEKNEML
KTLEGGLKPAE
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaatttacgtcatgccgtcattgccaatgtcaccggcaataatcaggagcag
cttgagcatacaatcgtagatgcgattcaaagcggtgaagaaaaaatgcttccagggctc
ggcgttttattcgaagtcatttggcagcacgcatccgaaagtgagaaaaacgaaatgctg
aaaacgcttgaaggcggattaaaacccgccgaataa

DBGET integrated database retrieval system