KEGG   Bacillus subtilis subsp. subtilis 168: BSU28670Help
Entry
BSU28670          CDS       T00010                                 

Gene name
ysfB
Definition
(RefSeq) hypothetical protein
  KO
K02647  carbohydrate diacid regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU28670 (ysfB)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    BSU28670 (ysfB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 Sigma70_r4_2
Motif
Other DBs
NCBI-GeneID: 937437
NCBI-ProteinID: NP_390745
Pasteur: BG12319
BSORF: BG12319
UniProt: P94536
Position
2931976..2933082
Genome map
AA seq 368 aa AA seqDB search
MFLQPLLAKKIIAEVKKMYEREVIIVNTDGLIMAGTNDERVGQFHEGALICAKERRSVII
TKEDETRLKGVKAGINLPVFFDHDVIAVFGLTGEPAEIQPFGELLRKMTELFIKESRHLE
QSQWRERMLESFMIDWLQLKEWSPSFLEKAQLLGVDLSSRRQMILIQGYEWSPHDIEQMA
RSWKSSYPADLFIRWGNERILINHEVPQHEQRDRLLRKILHICSFANTASSQYTAAGAGR
AVASSSLTDSYEQAEKALAVSLKRKTPIFEEDLKLDMCLTEISPGTRNEFPQRVLGKALE
HQELMNTIRTFFHHDLSLKQTAEDMHIHINTLRYRLAKAEQLTGLRFDRTEDVVTMYVAL
YFLDQDTK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtttttacagccgttattagcgaaaaaaattattgctgaagttaaaaaaatgtacgaa
cgtgaagtcattattgtaaacacggacggtcttattatggcaggcacaaacgatgagcgt
gtcggacaatttcatgagggagcgcttatctgcgcaaaagaaagacgcagcgtgattatt
acaaaagaagatgaaacaaggttaaaaggagtgaaagcaggcataaacctccctgtattt
tttgaccatgatgtgattgccgtcttcgggctgacaggtgagcctgcagagattcagcca
ttcggagaactgcttcgaaaaatgacagaactgttcattaaggaatcgcggcacttagag
caatcccagtggcgtgagagaatgctggagtcctttatgatcgattggctgcaattaaag
gagtggtctcccagttttcttgagaaagctcagcttcttggtgttgacctttcttcccgg
cgccaaatgattcttattcaggggtatgagtggtcacctcatgatattgaacaaatggca
cgcagctggaaatcctcgtaccctgcggatttgttcatcaggtggggaaatgaacggatt
ttgattaatcatgaagtgccgcagcatgaacaaagggatcggcttttgcggaaaatcctt
cacatttgttcgtttgccaataccgcaagcagccaatatacagcagctggcgccggaagg
gctgtcgcaagctccagcctgacagattcatacgagcaagcggaaaaagcgctggctgtc
agccttaagcgaaaaacgcccatatttgaagaggatctgaagcttgatatgtgtctgacg
gagatcagcccgggaacccgaaacgaatttccgcaaagagtattaggaaaggcgctagag
catcaggaacttatgaatacgatacggactttctttcatcacgatttgtctttgaaacaa
accgctgaagacatgcatatacacatcaatacattgcgttatcgtctggctaaggctgaa
cagctgacgggattacgttttgaccgtaccgaggacgtcgtcacgatgtacgtcgcactc
tattttttagatcaagatacaaaatag

DBGET integrated database retrieval system