KEGG   Bacillus subtilis subsp. subtilis 168: BSU28680Help
Entry
BSU28680          CDS       T00010                                 

Gene name
glcD
Definition
(RefSeq) glycolate oxidase subunit GlcD
  KO
K00104  glycolate oxidase [EC:1.1.3.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU28680 (glcD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     BSU28680 (glcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 937770
NCBI-ProteinID: NP_390746
Pasteur: BG12320
BSORF: BG12320
UniProt: P94535
Position
2933185..2934597
Genome map
AA seq 470 aa AA seqDB search
MITKDVKEQLIQVSGPENFDDSNAGRLVYSYDATPQYQSMPDAVIAPRNTDEISRILTIC
SEHRVPIVPRGSGTNLCGGTCPTEGGLVLLFKHMNQILEIDEENLTATVQPGVITLDMIR
AVESKGLFYPPDPSSMKISTIGGNINENSGGLRGLKYGVTRDYVIGLEVVLANGDIIRTG
GKLAKDVAGYDLTRLFVGSEGTLGIVTEAIVKLVPKPETKKTLLALYENIDAAAQTVSDI
IAAKIIPATLEFLDQPTLLVIEDYAKIGLPTSAKAVLLIEQDGPFETVERDMEKIEAICK
KGDAVSVQTAQTEEEAFALTEARRSALSALARLKPTTILEDATVPRSEIANMVKAINDIA
AKYDISICTFGHAGDGNLHPTCTTDIRNKDEMERVEQAFAEIFEKAIELGGTITGEHGVG
EMKAPYLEMKLKKEGIDAMKALKAAFDPRNILNPGKMFAKDARKRVVAER
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaaggatgtaaaggagcagctgattcaggtctccggaccagaaaactttgat
gactcgaatgccggccgtctcgtctattcatatgatgcgacgcctcagtatcagtctatg
cctgatgccgtgattgctccgaggaatactgatgaaatatcacgcattttaacaatttgc
agcgaacatcgagtgccgatcgttccaagaggatcagggacaaacctgtgcggcggcacg
tgcccgactgaaggcggacttgtgcttctctttaagcacatgaaccagattcttgaaatt
gatgaagaaaatttaactgccacagttcagccgggcgtcattacgttggatatgatccgg
gcagttgaaagcaaaggtttattttatccgcctgacccgagttctatgaaaatatcaact
atcgggggcaacatcaatgaaaattccggcgggctacgcggattaaaatacggtgtcacc
cgcgactatgttattggactggaggttgttctcgcaaatggtgacatcatccgcaccggc
ggaaaactcgcaaaggatgtggccggatacgatctcacacgtctttttgtcggctcagaa
ggaacactcggcattgtgacagaggcaatcgtcaaactcgttccaaagccggaaacaaag
aagacgctgcttgccctttatgaaaacatcgatgccgctgctcaaacggtatcggacatt
attgccgcaaaaattatacccgctacgcttgaatttctcgatcagcctacactattggtg
attgaggattatgccaaaatcggacttccgacaagcgcaaaagcagttctgttaattgaa
caagacgggccatttgaaactgttgaacgggatatggaaaagattgaggcgatctgcaaa
aaaggcgacgccgtatccgttcagaccgcacaaacagaggaggaagcgtttgccctgact
gaagcccggcgttctgcactttctgccctagcccgcctcaaaccgacgacgattttagag
gatgcgaccgttcctcgctcagaaatcgccaatatggttaaagcgattaatgatattgct
gctaaatatgatatttccatctgcacctttggtcatgcgggagacgggaaccttcacccg
acatgcacgacagacataagaaataaggatgaaatggaacgtgtcgaacaggcttttgcc
gagatttttgagaaagcgattgaacttggcgggacgataaccggagagcacggagtcggg
gaaatgaaagcgccttacttggaaatgaagctgaaaaaagaaggcattgatgcgatgaaa
gcgttgaaagcggcatttgacccccggaacatattaaatcccggcaaaatgtttgcgaaa
gatgccagaaaacgtgtggtggcggaaagatga

DBGET integrated database retrieval system