KEGG   Bacillus subtilis subsp. subtilis 168: BSU28690Help
Entry
BSU28690          CDS       T00010                                 

Gene name
glcF
Definition
(RefSeq) glycolate oxidase iron-sulfur subunit
  KO
K11473  glycolate oxidase iron-sulfur subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU28690 (glcF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG Fer4_8 Fer4_17 Fer4_7 Fer4_10 Fer4 Fer4_16 Fer4_9 Fer4_4 Fer4_2 Fer4_18 Fer4_6 Fer4_3
Motif
Other DBs
NCBI-GeneID: 937435
NCBI-ProteinID: NP_390747
Pasteur: BG12321
BSORF: BG12321
UniProt: P94534
Position
2934594..2935928
Genome map
AA seq 444 aa AA seqDB search
MTTEKEMKQIQNEFKERMDEGELLNCMRCGFCLPSCPTYIESGFQETHSPRGRIALMKAV
ADGMIEPDEDVERSLSLCLGCRACEPVCPSGVKYGQLLEEARDIIHQNKKHSLGERVMRK
TAFHELFPHQNRMRSAVSLIGLYQRSGLQTAVRKSGMLRVLPEHLRTMEAVLPDVPKSKD
MKHRPRFLPSIGPMKKRVAFFSGCLMDTMFLPTNNATLKLLQLAGCDIVIPPEQACCGAL
HGHSGEKNTGKELAKQNIAAFEALDVDAVITNAGGCGAFLTEYDHLLKDDPEWSERAAAF
VQKLKDFSSVLVELDFHQMDLALETPQVVTYQDSCHLRNVMHTSLEPRQLLKSIKGAEFK
EMEKADSCCGSAGIYNIVEVEMSMKILDSKMAAVKATEAILIVTANPGCLLQMKLGIERE
GLSGKVRAVHLADLLLEAAGHKTS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaaaaagaaatgaaacagatccaaaatgaatttaaagagcgtatggatgaa
ggagagttattaaattgtatgcgctgcggcttctgtcttccttcctgtccgacctatatc
gaatcgggatttcaggaaacacactctccgcgtgggcgcatcgccttaatgaaagccgta
gccgacggtatgattgaaccggatgaagatgtcgaacggtcgctgtcactttgcctcggc
tgccgcgcctgtgagcctgtatgcccgtctggcgtgaaatacgggcagctgcttgaggaa
gccagagatattatccaccaaaataaaaaacactctcttggtgaacgtgtcatgcgaaag
acggcttttcacgagctgtttccgcatcaaaaccgcatgcgctcagctgtaagccttatc
ggtttgtatcagcgttcaggactgcaaaccgctgtgcgaaaatcaggcatgcttcgggtc
ctgcctgagcatttgcggacgatggaagctgttcttcctgatgttccaaaaagcaaagac
atgaaacatcggccgcgtttcctgccttccattggccccatgaaaaaacgggtcgccttt
ttttcgggctgcttaatggatacaatgtttttaccgaccaataacgccacattgaagctt
ttacagctggcaggctgcgacattgtcattccgcctgaacaggcttgctgcggggcgctt
catggacacagcggtgaaaaaaacacagggaaagagctcgcgaaacaaaatatcgctgct
ttcgaagcattagacgtggatgcagtcattacaaacgcaggaggatgcggagcctttctc
actgaatatgatcatttgctgaaggatgaccctgagtggtcggaacgggctgccgctttt
gttcaaaagctgaaggatttttcttctgttttggttgaactcgatttccatcaaatggat
ctagcactcgagacgcctcaggtcgttacctaccaagattcatgtcatctaagaaatgtg
atgcatacgtcactcgagccccgccagcttcttaaaagcatcaaaggggcggaattcaaa
gaaatggagaaagcagacagctgctgcgggtcagcgggaatttacaacatcgtcgaagtt
gaaatgtctatgaaaatactggacagcaaaatggctgccgtcaaagcaaccgaagcgatc
ctcattgtaacagcaaatcctggctgcctgctgcagatgaagctcggcattgaacgcgaa
ggactaagcggtaaagtcagagccgttcacctggctgatttgctattagaagcagccggg
cacaaaacatcatga

DBGET integrated database retrieval system