KEGG   Bacillus subtilis subsp. subtilis 168: BSU28700Help
Entry
BSU28700          CDS       T00010                                 

Gene name
ysfE
Definition
(RefSeq) hypothetical protein
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU28700 (ysfE)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     BSU28700 (ysfE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_2 Glyoxalase Glyoxalase_6 TxDE Glyoxalase_4 DUF1421
Motif
Other DBs
NCBI-GeneID: 937588
NCBI-ProteinID: NP_390748
Pasteur: BG12322
BSORF: BG12322
UniProt: P94533
Position
complement(2935967..2936209)
Genome map
AA seq 80 aa AA seqDB search
MALNTRESARDITALDIPDTSASNTFEIGFVTENVEAVIKRMREQGVSIIGEPKVKPWGQ
TVAYIADPDGHYIEICSPME
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcttaatacccgggaaagcgccagagacatcacggcgctggacattccggataca
tctgcttcaaacacatttgaaatcgggtttgttactgaaaatgtagaagcggtcatcaaa
aggatgagagaacaaggcgtatcgattatcggggagccgaaagtgaaaccatgggggcag
acggtcgcctatatcgctgatccggatggacattatatcgaaatttgcagtccgatggaa
taa

DBGET integrated database retrieval system