KEGG   Bacillus subtilis subsp. subtilis 168: BSU28710
Entry
BSU28710          CDS       T00010                                 

Gene name
cstA
Definition
(RefSeq) carbon starvation protein A
  KO
K06200  carbon starvation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU28710 (cstA)
SSDB
Motif
Pfam: CstA CstA_5TM UVB_sens_prot
Other DBs
NCBI-GeneID: 937970
NCBI-ProteinID: NP_390749
Pasteur: BG11924
BSORF: BG11924
UniProt: P94532 A0A6M3ZJU8
Position
complement(2936382..2938178)
AA seq 598 aa
MNAVTIVIASMCILAIAYRLYGTFMMVKVLKVNDDKPTPAHALEDGKDYVPTNKWVSFGH
HFAAIAAAGPLVGPILAAQFGYLPGLLWLLIGAVIGGAVHDIVVLFASMRKNGKSLSEVA
KDELGPVAGFCTGLSMLFIITITMAGLSMVVLHALERNPWGTFAVGITIPIAMGVGLFYK
KTGNLKLASTVGFLFLMAGVFIGPWVQTTALGDFLTLDTKTLAIALPVYAFFAAALPVWL
LLAPRDYLSSFMKIGVFIALIVGVFVVNPSIPFPAFTEFVKGGGPVLAGPVWPFISITIA
CGAISGFHAFVGSGTTPKMLNKWSDMKPVAFGAMLVECLVGIMALIAATALQPADYFAIN
STPEVFRTLGMNVVHLPELSGEIGLDLEGRTGGAVTLAVGMTYIFTGMPFFSHLASYFFQ
FVIMFEAVFILTAIDAGTRVARYLIQDFFGEVYKPLKKTDWIPGSVFASALACLMWGYLL
YSGDIGSIWALFGVSNQLMASVGLIIGATIVLKIADKRRYILTCLIPLAYLYVTVNYAGY
WMVRNVYLNPEAAGYSVLNGVLSIIMLVLGFIIIVAAVKKWAQMWKDPSLRMEASIPG
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgaatgcggttacaattgtgatagcatcaatgtgtattttggctattgcctatcgttta
tacggaacatttatgatggtgaaggttctcaaagtgaatgatgacaagccaacacctgct
catgcgcttgaggatgggaaagactatgtgcctacaaataaatgggtttcgttcggccac
cactttgccgcgatcgcagcggccgggccgctggtcggaccaattctggcggcgcagttt
ggctatttgccgggattattgtggctgttaatcggggcggtaattgggggagccgtccat
gatattgtggtgttgtttgcatcgatgcgcaaaaacggaaaatcgctgtcggaagtggcg
aaggatgagcttggccctgttgcaggattttgtacaggactgtccatgctgtttatcatc
acgatcacaatggcgggcctgtcgatggttgtcttgcatgcgcttgaacgtaatccatgg
ggaacatttgcggtggggattacgattccgattgcgatgggtgtgggcttattttataag
aaaacgggaaatttaaagctcgcttcaacggtcggctttctctttttaatggcaggagtc
tttatcggtccatgggtacagactaccgcgctcggtgactttttaacgctagatacgaaa
acgcttgcaatcgcgcttcctgtttatgcgttttttgcggctgcgcttcccgtttggctg
cttctggctccgcgtgattatttaagcagctttatgaaaatcggtgtttttatcgctttg
attgttggtgtgtttgtcgtcaatccgtccattccgttccctgcgtttacagaattcgta
aaaggcggagggccggtgctggcaggacctgtctggccgttcatctcaataaccatcgcc
tgcggggcgatctctgggttccatgcctttgtcggctcaggaacgacaccgaaaatgctg
aataaatggagtgatatgaagccggttgcgtttggcgcaatgcttgttgagtgtcttgtc
ggtatcatggcgctgattgcagcgaccgctttacagcctgctgattactttgcgattaac
agcacgcctgaggttttccgtacgcttggcatgaatgtcgtacatttgcctgaattgagc
ggggaaatcggtttggacttagaaggaagaacagggggagccgtcacgcttgcggtaggg
atgacttatatttttaccggaatgccgtttttcagccatttggcctcatactttttccaa
tttgtcattatgtttgaagcggtctttattttaacagcgattgacgccggcacacgtgtc
gcccgttatttgatccaggacttcttcggggaggtgtataagccgctgaagaaaacagac
tggattccgggctctgtatttgccagcgcgcttgcctgtttgatgtgggggtacttgctg
tattcaggagatatcggttccatttgggcgctcttcggcgtttctaatcagctgatggct
tcagtggggctgattatcggagcgacgatcgtgctgaaaatcgccgataaacgccggtac
attctgacttgccttatcccgcttgcctatttatatgtcactgtcaattatgcgggctat
tggatggtgcgcaatgtgtatctcaatcctgaagcagcaggatatagtgtattgaatggc
gtattatctatcatcatgctggtgttaggcttcatcattatcgtggcggctgtgaaaaaa
tgggcgcagatgtggaaagatccgagcttaaggatggaagcatctataccgggctag

DBGET integrated database retrieval system