KEGG   Bacillus subtilis subsp. subtilis 168: BSU28730
Entry
BSU28730          CDS       T00010                                 

Gene name
araQ
Definition
(RefSeq) L-arabinose transport system permease protein AraQ
  KO
K17236  arabinooligosaccharide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU28730 (araQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU28730 (araQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Arabinooligosaccharide transporter
    BSU28730 (araQ)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 937434
NCBI-ProteinID: NP_390751
Pasteur: BG11912
BSORF: BG11912
UniProt: P94530 A0A6M3ZEV3
Position
complement(2939851..2940696)
AA seq 281 aa
MLRHSPQFSVYRIALTLFFMMLSLLYLFPIFCLLLGSLKPSSELLRVGLNLDIDPKVMSF
DNYTFLFNGGSIYFKWFFNSLVLGLFTTVLTLFFSSMIGYGLAVYDFKGRNIIFVLVLII
MMVPLEVMMLPLFKLTVGLHLIDSYTGVILPFIVSPVAVFFFRQYALGLPRDLLDSARMD
GCTEFGIFFRIMAPLMKPAFGAMIILQSLNSWNNFLWPLIVLRSKEMFTLPIGLSSLLSP
YGNNYDMLISGSVFAILPVIIIFLFFQKYFISGLTVGGVKG
NT seq 846 nt   +upstreamnt  +downstreamnt
atgttgcggcacagtcctcagtttagcgtttatagaattgcgctgaccctgttttttatg
atgctgagcctattgtatctttttccgattttctgtttgcttttaggatcattaaagccg
tcatctgagcttttgcgtgtggggctgaatcttgatattgatccaaaagtgatgagtttt
gataactacacatttctgtttaatggcggcagcatttatttcaaatggttttttaacagt
cttgtactcggactttttacgactgtgctcactctgtttttttcttcgatgatcgggtac
gggcttgcggtttatgattttaagggcagaaatatcatctttgttcttgtgctgattatt
atgatggttccgctggaagtgatgatgcttcctctgtttaaacttactgtcggactgcac
ttgatcgattcatatacgggtgtcatattgccgtttatcgtttcacctgttgctgttttc
tttttcaggcaatatgctcttggccttccaagagatctgctggactctgcaaggatggac
ggctgtacggaattcggcatctttttcaggattatggcaccgctgatgaaaccggctttc
ggtgcgatgattatccttcagtccttaaacagctggaacaacttcttgtggccgctgatt
gtgcttcggtcgaaagaaatgtttacgcttccaatagggctgtccagcttgctgagccct
tatggaaataattacgacatgcttatatccggctcagtatttgcgattttgccggtgatt
atcattttcttgtttttccaaaagtactttatctccggcctgacggtagggggagtcaaa
ggttaa

DBGET integrated database retrieval system