KEGG   Bacillus subtilis subsp. subtilis 168: BSU28740
Entry
BSU28740          CDS       T00010                                 

Gene name
araP
Definition
(RefSeq) L-arabinose transport system permease protein AraP
  KO
K17235  arabinooligosaccharide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU28740 (araP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU28740 (araP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Arabinooligosaccharide transporter
    BSU28740 (araP)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 937432
NCBI-ProteinID: NP_390752
Pasteur: BG11911
BSORF: BG11911
UniProt: P94529 A0A6M3ZF96
Position
complement(2940697..2941638)
AA seq 313 aa
MKPVKTGTVHPVPSAAKQSGWRDLFYSKKAAPYLFTAPFVLSFLVFFLYPIISVFIMSFQ
RILPGEVSFVGLSNYTALNNPTFYTALWNTLEYTFWTLIVLIPVPLLLAIFLNSKLVKFR
NIFKSALFIPALTSTIVAGIIFRLIFGEMETSLANSILLKLGFSPQNWMNNEHTGMFLMV
LLASWRWMGINILYFLAGLQNVPKELYEAADIDGANTMKKFLHITLPFLKPVTVYVLTIS
IIGGFRMFEESYVLWQNNSPGNIGLTLVGYLYQQGLAYNEMGYGAAIGIVLLIVILVVSL
ISLKLSGSFKGEG
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaacctgtgaaaacgggaacggttcatcccgttccttcagctgcgaaacaatcaggc
tggcgagatctgttttattcaaaaaaagcggcgccctatctgtttacagcgccattcgtt
ttatcctttctcgtattttttctataccccatcattagtgtcttcatcatgagcttccaa
agaattttgccgggagaggtgtcctttgtcggattgtctaattatacagcgctaaacaac
ccgacgttctataccgccctttggaatacgctggaatacaccttttggacgctgatcgtg
ctgattcctgttccattgcttctggccatattcctgaattcaaagctggtcaaatttaga
aatatatttaaatcagcattatttatcccggcattgacctcaaccattgtcgcggggatc
atttttcggctgatcttcggagaaatggaaacgtctctggccaattccatcctacttaaa
ctcggcttttcacctcagaactggatgaacaatgaacataccggcatgtttttgatggtg
ctgcttgcttcatggagatggatgggaatcaacatcctttactttttagcaggtttgcaa
aatgtgccgaaagagctgtacgaagccgctgatatagacggcgcgaatacaatgaaaaaa
tttctgcacatcacgctgccgtttctcaagcctgtaaccgtatatgtgctgaccatcagc
atcatcggcggcttcaggatgtttgaggaaagctacgtcctttggcagaataattccccg
ggtaatattggtctgacgcttgtcggatatttgtatcagcagggacttgcctacaatgaa
atgggatacggagcggccatcggcattgtgcttttgattgtgatccttgttgtcagcctg
atttcattaaagctgtcaggctcgtttaagggggagggataa

DBGET integrated database retrieval system