KEGG   Bacillus subtilis subsp. subtilis 168: BSU28750
Entry
BSU28750          CDS       T00010                                 

Gene name
araN
Definition
(RefSeq) arabinose-binding protein
  KO
K17234  arabinooligosaccharide transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU28750 (araN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU28750 (araN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Arabinooligosaccharide transporter
    BSU28750 (araN)
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8
Other DBs
NCBI-GeneID: 937433
NCBI-ProteinID: NP_390753
Pasteur: BG11910
BSORF: BG11910
UniProt: P94528 A0A6M3ZF97
Position
complement(2941674..2942975)
AA seq 433 aa
MKKMTVCFLVLMMLLTLVIAGCSAEKSSGKSGETELTFWTFNGLHEQFYVEMVKEWNKKY
PDRKIKLNTVVYPYGQMHDNLSISLIAGEGVPDIADVELARFSNFLKGSDIPLADLTPLI
EKDRDKFVEARLTLYSKNGKLYGLDTHVGTTVMFYNMDVMKKAGVNPDDIKTWDDYHKAG
QKVRKVTGKPMGTVETNDSATFLSMISQQNSGYFDKNGKLILNNDTNVKTLQYLKDMIND
KTMIPAPGGGHHSEEYYGFMNQGGAASVLMPIWYMGRFIDYMPDLKGKIAIRPLPAWKEG
GDRSAGLGGTATVVPKQSKHVELAKEFLAFAKGSEEGNKKLWSVLGFDPLRWDVWSSKEL
KEKNKYTDYFQNGTGIFSVLLDIKDEINPIYLHEDFAKASDLVNRSVLFDALKSQQKTPK
QALDRAAGELKQK
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaaatgactgtctgttttcttgtgctcatgatgttgctgacattagtcattgcc
gggtgttcagcagaaaaatcatccggcaaatcgggtgaaactgagctgaccttttggaca
tttaacgggcttcatgagcagttctatgtggaaatggtgaaggaatggaacaaaaaatat
cctgaccgcaaaattaagctgaatacggtcgtttatccatatggacaaatgcacgataac
ttatctatctccctaatagcgggagaaggcgttcctgatattgcagatgtcgaattggcc
cgtttttcaaactttttgaagggctctgacataccgcttgccgacttgactccgctgatt
gaaaaggatcgcgataaattcgttgaggcgcggctgacattgtacagcaaaaacggaaag
ctttacggactcgatacacatgtagggacaacggtcatgttttataacatggatgtgatg
aaaaaagccggcgtcaatcctgacgatattaaaacatgggatgattaccataaagccgga
cagaaagtgcgcaaagtgaccgggaagccgatgggaacggtggaaacaaatgattccgca
acgttcttatctatgatttcacagcaaaactcaggctattttgataaaaacggcaagctg
atcctcaataatgacaccaacgtaaaaacacttcaatatttaaaagacatgatcaatgat
aaaacgatgattcctgcgccgggcggcgggcatcacagtgaagaatactacggctttatg
aaccaaggaggagctgcttcagttctcatgccgatttggtatatgggaagatttatcgat
tatatgcctgatctgaaagggaagattgccatcagaccgctcccggcatggaaagagggg
ggcgaccgctcggcaggtttgggcggtacggcaactgttgtaccgaagcaatccaagcat
gttgagttagcaaaagagtttttggcctttgcgaagggctctgaagaaggaaataaaaaa
ctctggagcgtactcggctttgacccgcttcgctgggatgtttggagctccaaggaattg
aaagagaaaaacaaatacacggattacttccaaaacggaacaggcattttttctgtgctg
ctcgatatcaaggatgaaatcaatccaatttatttacatgaggattttgccaaggcttca
gaccttgtcaacagaagcgtattgttcgacgcgcttaaatctcagcaaaaaacgcctaaa
caagccttggacagagcggcaggtgaactgaaacagaaatag

DBGET integrated database retrieval system