KEGG   Bacillus subtilis subsp. subtilis 168: BSU28760
Entry
BSU28760          CDS       T00010                                 

Symbol
araM
Name
(RefSeq) glycerol-1-phosphate dehydrogenase
  KO
K00096  glycerol-1-phosphate dehydrogenase [NAD(P)+] [EC:1.1.1.261]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU28760 (araM)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.261  sn-glycerol-1-phosphate dehydrogenase
     BSU28760 (araM)
SSDB
Motif
Pfam: Fe-ADH_2 Fe-ADH DHQ_synthase
Other DBs
NCBI-GeneID: 938011
NCBI-ProteinID: NP_390754
Pasteur: BG11909
BSORF: BG11909
UniProt: P94527 A0A6M4JKW3
Position
complement(2943006..2944190)
AA seq 394 aa
MNRIAADVQRAFENAGEKTLPIKVEEIVLGKQAADSLLDYVKRKNNQHIVLVCDANTHRI
AGIDLENRLNQEGFQAECLIIPENEAGDVTADERSLIHVLIHTKQPTDVMIAVGSGTIHD
IVRFAAFQRDLPFISYPTAPSVDGFTSAGAPIILYGTKTTIQTKAPSALFADLDLLKAAP
QSMVAAGFGDMLGKITSLADWEISRHLAGEPYSPAGAKIVQEALAACIEHTEDIAMKTET
GIRVLMESLLVSGLVMLALDHSRPASGGEHHISHWIEMELMEKKRPQILHGAKVGCAAVL
LTDTYRKLAQDDGLNEFSPSRREAIQSAYQTLPRGEVLADWLRSAGGPAYFDEIGVGQDS
VKNAFRHAHTLRDRCTGLRIINENKTLINHGLYE
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaatcgtatcgcagctgacgttcagcgtgcttttgaaaacgccggagaaaagacgttg
cctataaaagttgaagaaattgttctcggtaagcaagcagctgattcgcttttggattat
gtaaaacgaaaaaacaatcaacatattgtccttgtctgcgacgcgaatacacaccgcatt
gcaggaattgatttagaaaaccgactgaatcaagaaggatttcaggccgagtgcctgatc
attccagaaaatgaagccggagatgtgacagctgatgaacgatcgctcattcatgtgctg
atccatacgaaacaaccaacggatgtcatgatcgcagtcggttcgggcacgattcatgat
atcgtccgctttgcggcgtttcaaagagatttgccgtttatttcttatccgactgctcca
tctgtagacggttttacatcagccggtgcgccgattattttatacggcacgaaaacaacc
attcaaacgaaggccccatctgcgctgttcgctgatctggatctattaaaagcggcaccg
cagtcaatggtggcggctggctttggtgacatgctcggtaaaatcacgtctttagcagat
tgggaaatatcccggcatcttgccggtgagccttattcgcctgcaggagctaagatcgtt
caggaggcgcttgctgcctgcattgaacacacagaagacattgcgatgaaaacggaaact
ggcatacgggttttgatggagtctttacttgtatcggggcttgtcatgctggcattagat
cattcccgaccggcatcaggcggcgagcatcatatttcacattggattgaaatggagtta
atggagaaaaaacggcctcagattcttcatggggcaaaggtgggctgtgccgctgtttta
ttaactgacacatacagaaagctcgctcaggatgacgggctgaacgaattttcaccaagc
cgccgggaagccatccaatcggcttatcaaacactcccgagaggagaagtgctggctgat
tggctgagatcagccggaggccctgcgtattttgacgaaatcggtgtcgggcaggattcc
gtcaaaaatgccttcagacacgcgcacaccttaagagaccgatgcaccggattaagaatc
atcaatgaaaacaaaacgctgatcaaccatggtctatatgaatag

DBGET integrated database retrieval system