KEGG   Bacillus subtilis subsp. subtilis 168: BSU28780
Entry
BSU28780          CDS       T00010                                 

Symbol
araD
Name
(RefSeq) L-ribulose-5-phosphate 4-epimerase
  KO
K03077  L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00053  Ascorbate and aldarate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU28780 (araD)
   00053 Ascorbate and aldarate metabolism
    BSU28780 (araD)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     BSU28780 (araD)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-GeneID: 937894
NCBI-ProteinID: NP_390756
Pasteur: BG11906
BSORF: BG11906
UniProt: P94525 A0A6M3ZF01
Position
complement(2944983..2945672)
AA seq 229 aa
MLETLKKEVLAANLKLQEHQLVTFTWGNVSGIDREKERIVIKPSGVEYSDLTADDLVVLN
LDGEVVEGSLKPSSDTPTHVYLYKAFPNIGGIVHTHSQWATSWAQSGRDIPPLGTTHADY
FDSAIPCTREMYDEEIIHDYELNTGKVIAETFQHHNYEQVPGVLVNNHGPFCWGTDALNA
IHNAVVLETVAEMAYHSIMLNKDVTPINTVLHEKHFYRKHGANAYYGQS
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcttgaaacattaaaaaaagaagtgctggctgccaacctgaagcttcaagagcatcag
ctggtaacctttacgtggggaaatgtcagcggcattgaccgtgaaaaagaaagaattgtc
atcaaacctagcggagtcgaatacagcgacctgacagccgatgacttggttgttttgaac
cttgatggagaggtcgtcgaaggctcgcttaaaccttcttcagatacacctacccatgtt
tatctatataaagcctttccgaatatcgggggaattgtccatacccattctcaatgggcg
acaagctgggcgcaatcgggcagagacatccctccgttaggcacgacccatgctgattat
tttgacagtgcgattccatgtactcgagaaatgtacgatgaagaaatcattcatgactac
gaactgaatacaggaaaagtcatagcggaaacctttcagcatcataattacgaacaggtg
ccgggtgtgctcgtgaataatcacggaccgttctgctggggcactgacgccttaaatgcc
attcataacgcagttgtattagaaacggttgccgaaatggcctatcactccattatgctg
aacaaggatgtaaccccaatcaatacagtcctgcatgaaaagcatttttatcgaaaacac
ggagcaaatgcgtattatggccagtcatga

DBGET integrated database retrieval system