KEGG   Bacillus subtilis subsp. subtilis 168: BSU28790
Entry
BSU28790          CDS       T00010                                 

Gene name
araB
Definition
(RefSeq) ribulokinase
  KO
K00853  L-ribulokinase [EC:2.7.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU28790 (araB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.16  ribulokinase
     BSU28790 (araB)
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-GeneID: 936019
NCBI-ProteinID: NP_390757
Pasteur: BG11905
BSORF: BG11905
UniProt: P94524 A0A6M3ZI76
Position
complement(2945689..2947371)
AA seq 560 aa
MAYTIGVDFGTLSGRAVLVHVQTGEELAAAVKEYRHAVIDTVLPKTGQKLPRDWALQHPA
DYLEVLETTIPSLLEQTGVDPKDIIGIGIDFTACTILPIDSSGQPLCMLPEYEEEPHSYV
KLWKHHAAQKHADRLNQIAEEEGEAFLQRYGGKISSEWMIPKVMQIAEEAPHIYEAADRI
IEAADWIVYQLCGSLKRSNCTAGYKAMWSEKAGYPSDDFFEKLNPSMKTITKDKLSGSIH
SVGEKAGSLTEKMAKLTGLLPGTAVAVANVDAHVSVPAVGITEPGKMLMIMGTSTCHVLL
GEEVHIVPGMCGVVDNGILPGYAGYEAGQSCVGDHFDWFVKTCVPPAYQEEAKEKNIGVH
ELLSEKANHQAPGESGLLALDWWNGNRSTLVDADLTGMLLGMTLLTKPEEIYRALVEATA
YGTRMIIETFKESGVPIEELFAAGGIAEKNPFVMQIYADVTNMDIKISGSPQAPALGSAI
FGALAAGKEKGGYDDIKKAAANMGKLKDITYTPNAENAAVYEKLYAEYKELVHYFGKENH
VMKRLKTIKNLQFSSAAKKN
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggcttacacaataggggttgattttggaactttatcaggaagagcagtgctcgttcat
gtccaaacaggggaggaacttgcggctgctgtaaaagaatacaggcatgctgtcattgat
accgtccttccaaaaacgggtcaaaagctgccgcgtgactgggcgctgcagcaccctgct
gattacctcgaagtcttggaaacaaccattccgtctttactcgaacagacgggcgttgac
ccgaaagacattatcgggattggaattgatttcacggcatgtacgatccttcctattgac
agcagcgggcagccgttatgcatgctgcctgaatatgaagaggagccgcacagctatgtg
aagctctggaagcatcatgcggcccaaaaacatgctgatcggctcaatcaaatcgcggaa
gaagaaggagaggcttttttacagcggtacggaggaaaaatttcatcagaatggatgatt
ccaaaggtcatgcaaattgccgaggaagcgcctcacatttatgaagcggctgaccggatc
atcgaggctgcggactggatcgtgtaccagctgtgcggctcgctcaagcgaagcaattgt
accgcagggtataaagcgatgtggagtgaaaaagcggggtatccgtcagatgatttcttt
gagaaattaaatccttcaatgaaaacgattacaaaggacaaattgtcaggttctattcat
tcagtaggagaaaaagccggcagtctgactgaaaaaatggcaaagctgacagggcttctc
ccgggaacggctgttgcggttgccaatgtggacgctcatgtttcggtaccggcggtcggc
attacagagccagggaaaatgctgatgattatgggaacctcgacgtgccatgttctactt
ggtgaagaggtgcatatcgttccaggaatgtgcggcgttgtggacaacggaattctcccg
ggctatgcgggatatgaagccgggcagtcctgtgtcggcgatcattttgactggtttgtg
aaaacatgtgtcccgccagcttatcaagaggaagcaaaggaaaaaaacattggcgttcat
gagctgctgagtgagaaagcaaaccatcaagcgcctggtgaaagcggcttgcttgcttta
gattggtggaatggaaaccgttcaactcttgttgatgcagatttaacagggatgctgctt
ggcatgacactgctgacgaagcctgaagagatttatagagcgttagttgaagcgacagct
tacggaacccggatgattatcgaaacattcaaagaaagcggtgttccgattgaggaactg
ttcgcagccggcggaatagctgagaaaaacccgtttgtcatgcagatttatgcggatgtg
acaaacatggacattaaaatctctggttcaccgcaagccccagccttaggatctgccatt
ttcggcgcgcttgcagcaggcaaagaaaaaggcggctacgatgatatcaaaaaggcagcg
gcgaacatgggaaaactgaaagatataacttatacgccaaatgccgaaaacgccgcggtt
tatgaaaaattgtacgctgaatataaagagctggttcattatttcggaaaagaaaaccat
gtcatgaagcgtctgaaaacgatcaaaaatcttcaattttcatctgccgccaaaaagaat
tga

DBGET integrated database retrieval system