KEGG   Bacillus subtilis subsp. subtilis 168: BSU28800
Entry
BSU28800          CDS       T00010                                 

Gene name
araA
Definition
(RefSeq) L-arabinose isomerase
  KO
K01804  L-arabinose isomerase [EC:5.3.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU28800 (araA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.4  L-arabinose isomerase
     BSU28800 (araA)
SSDB
Motif
Pfam: Arabinose_Isome Arabinose_Iso_C
Other DBs
NCBI-GeneID: 936764
NCBI-ProteinID: NP_390758
Pasteur: BG11904
BSORF: BG11904
UniProt: P94523 A0A6M4JMB4
Position
complement(2947385..2948875)
AA seq 496 aa
MLQTKDYEFWFVTGSQHLYGEETLELVDQHAKSICEGLSGISSRYKITHKPVVTSPETIR
ELLREAEYSETCAGIITWMHTFSPAKMWIEGLSSYQKPLMHLHTQYNRDIPWGTIDMDFM
NSNQSAHGDREYGYINSRMGLSRKVIAGYWDDEEVKKEMSQWMDTAAALNESRHIKVARF
GDNMRHVAVTDGDKVGAHIQFGWQVDGYGIGDLVEVMDRITDDEVDTLYAEYDRLYVISE
ETKRDEAKVASIKEQAKIELGLTAFLEQGGYTAFTTSFEVLHGMKQLPGLAVQRLMEKGY
GFAGEGDWKTAALVRMMKIMAKGKRTSFMEDYTYHFEPGNEMILGSHMLEVCPTVALDQP
KIEVHSLSIGGKEDPARLVFNGISGSAIQASIVDIGGRFRLVLNEVNGQEIEKDMPNLPV
ARVLWKPEPSLKTAAEAWILAGGAHHTCLSYELTAEQMLDWAEMAGIESVLISRDTTIHK
LKHELKWNEALYRLQK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgcttcagacaaaggattatgaattctggtttgtgacaggaagccagcacctatacggg
gaagagacgctggaactcgtagatcagcatgctaaaagcatttgtgaggggctcagcggg
atttcttccagatataaaatcactcataagcccgtcgtcacttcaccggaaaccattaga
gagctgttaagagaagcggagtacagtgagacatgtgctggcatcattacatggatgcac
acattttcccctgcaaaaatgtggatagaaggcctttcctcttatcaaaaaccgcttatg
catttgcatacccaatataatcgcgatatcccgtggggtacgattgacatggattttatg
aacagcaaccaatccgcgcatggcgatcgagagtacggttacatcaactcgagaatgggg
cttagccgaaaagtcattgccggctattgggatgatgaagaagtgaaaaaagaaatgtcc
cagtggatggatacggcggctgcattaaatgaaagcagacatattaaggttgccagattt
ggagataacatgcgtcatgtcgcggtaacggacggagacaaggtgggagcgcatattcaa
tttggctggcaggttgacggatatggcatcggggatctcgttgaagtgatggatcgcatt
acggacgacgaggttgacacgctttatgccgagtatgacagactatatgtgatcagtgag
gaaacaaaacgtgacgaagcaaaggtagcgtccattaaagaacaggcgaaaattgaactt
ggattaaccgcttttcttgagcaaggcggatacacagcgtttacgacatcgtttgaagtg
ctgcacggaatgaaacagctgccgggacttgccgttcagcgcctgatggagaaaggctat
gggtttgccggtgaaggagattggaagacagcggcccttgtacggatgatgaaaatcatg
gctaaaggaaaaagaacttccttcatggaagattacacgtaccattttgaaccgggaaat
gaaatgattctgggctctcacatgcttgaagtgtgtccgactgtcgctttggatcagccg
aaaatcgaggttcattcgctttcgattggcggcaaagaggaccctgcgcgtttggtattt
aacggcatcagcggttctgccattcaagctagcattgttgatattggcgggcgtttccgc
cttgtgctgaatgaagtcaacggccaggaaattgaaaaagacatgccgaatttaccggtt
gcccgtgttctctggaagccggagccgtcattgaaaacagcagcggaggcatggatttta
gccggcggtgcacaccatacctgcctgtcttatgaactgacagcggagcaaatgcttgat
tgggcggaaatggcgggaatcgaaagtgttctcatttcccgtgatacgacaattcataaa
ctgaaacacgagttaaaatggaacgaggcgctttaccggcttcaaaagtag

DBGET integrated database retrieval system