KEGG   Bacillus subtilis subsp. subtilis 168: BSU28810
Entry
BSU28810          CDS       T00010                                 

Gene name
abnA
Definition
(RefSeq) arabinan-endo 1,5-alpha-L-arabinase
  KO
K06113  arabinan endo-1,5-alpha-L-arabinosidase [EC:3.2.1.99]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU28810 (abnA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.99  arabinan endo-1,5-alpha-L-arabinanase
     BSU28810 (abnA)
SSDB
Motif
Pfam: Glyco_hydro_43 Glyco_hydro_32N
Other DBs
NCBI-GeneID: 937430
NCBI-ProteinID: NP_390759
Pasteur: BG11901
BSORF: BG11901
UniProt: P94522 A0A6M3ZJV7
Structure
PDB: 
1UV4

Position
complement(2949053..2950024)
AA seq 323 aa
MKKKKTWKRFLHFSSAALAAGLIFTSAAPAEAAFWGASNELLHDPTMIKEGSSWYALGTG
LTEERGLRVLKSSDAKNWTVQKSIFTTPLSWWSNYVPNYGQNQWAPDIQYYNGKYWLYYS
VSSFGSNTSAIGLASSTSISSGGWKDEGLVIRSTSSNNYNAIDPELTFDKDGNPWLAFGS
FWSGIKLTKLDKSTMKPTGSLYSIAARPNNGGALEAPTLTYQNGYYYLMVSFDKCCDGVN
STYKIAYGRSKSITGPYLDKSGKSMLEGGGTILDSGNDQWKGPGGQDIVNGNILVRHAYD
ANDNGIPKLLINDLNWSSGWPSY
NT seq 972 nt   +upstreamnt  +downstreamnt
ttgaaaaagaaaaaaacatggaaacgcttcttacacttttcgagtgcagctctggctgca
ggtttgatattcacttctgctgctcccgcagaggcagcgttttggggtgcatccaatgag
ctgcttcatgacccgactatgattaaagaggggagctcatggtatgcgctcggaacaggg
cttactgaagaacggggactgcgggttttgaagtcttcagacgctaaaaattggaccgta
caaaaatccattttcactacaccgctatcgtggtggtccaattatgtgccgaattatggc
caaaaccagtgggcgccggacatccaatactataacggcaagtactggctatattattcc
gtttcttcttttggaagcaatacatctgccattggcctggcatcttcaacaagcatcagt
tcggggggctggaaggacgagggcttggtgatccgttcgacaagctcaaataattataac
gccattgatccggagctgacattcgataaggatggcaacccgtggcttgcattcggctcg
ttttggagcggcattaagctgactaagctcgataagagtacaatgaagcctacaggctcg
ctctattcgattgcagctagaccgaataatggaggtgccttagaagctcctactcttacg
tatcaaaatggatattactatttaatggtttcatttgataaatgctgtgacggggtaaac
agtacgtacaaaattgcttacggaagatccaaaagcattacaggcccttatcttgataaa
agcggaaaaagcatgcttgaaggcggaggcaccattttggattcgggcaatgaccaatgg
aaaggacctggaggccaggatattgtgaacggaaacattcttgttcgccatgcctatgat
gccaatgacaacggcattccaaagcttctcatcaatgatttgaattggagctcgggctgg
ccgtcctattga

DBGET integrated database retrieval system