KEGG   Bacillus subtilis subsp. subtilis 168: BSU28820Help
Entry
BSU28820          CDS       T00010                                 

Gene name
ysdC
Definition
(RefSeq) aminopeptidase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 936750
NCBI-ProteinID: NP_390760
Pasteur: BG12317
BSORF: BG12317
UniProt: P94521
Structure
PDB: 

Position
complement(2950221..2951306)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGAENG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVLPGDMIVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDAVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAMLHRDDYENAVKLITEVIKKLDRKTVDEITY
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgaaagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcgcctgggcagtttaattgcaaaaaaaactggtgcagaaaacggc
ccgaaaattatgatcgccggacatttggatgaagtcggctttatggtgacacaaatcaca
gataaaggctttatccgttttcaaaccgttggcggctggtgggctcaggttatgcttgct
cagcgcgtcaccattgtcacaaaaaaaggagaaatcacaggggttatcggatctaagccg
cctcatattttgtctcctgaagcaagaaaaaaatcagtggaaataaaagacatgtttatt
gatattggagcttcaagccgggaagaagccttggagtggggtgtacttccgggagatatg
atcgttccgcattttgaatttacggtcatgaacaatgaaaaattcctactcgcaaaggcc
tgggacaaccgcatcggctgtgcgattgctattgatgtgttaagaaacttacaaaacaca
gatcatccaaatatagtgtatggcgtcggaaccgtgcaggaggaagtcgggctgagggga
gcgaaaacggctgcacacaccattcagcctgatattgcgtttggtgttgatgtagggata
gcaggagacacgcctggcatttccgagaaggaagcgcagagcaaaatgggcaaaggcccg
cagattatcgtttacgatgcatccatggtctctcacaaaggtttgcgcgatgcagttgta
gccactgcggaggaagccggcattccgtaccaatttgatgccattgccggcggcggaact
gattcgggtgccatccatttgacggcaaatggcgttcctgcgctgtccattaccattgca
acccgctacattcatacgcacgcggccatgctgcatcgtgatgattatgaaaacgcggta
aagttaattacagaagtcattaagaagttagaccgaaaaacggttgacgaaattacgtac
caataa

DBGET integrated database retrieval system