KEGG   Bacillus subtilis subsp. subtilis 168: BSU28830
Entry
BSU28830          CDS       T00010                                 

Symbol
ysdB
Name
(RefSeq) sigma-W pathway protein YsdB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF6304
Other DBs
NCBI-GeneID: 937429
NCBI-ProteinID: NP_390761
Pasteur: BG12316
BSORF: BG12316
UniProt: P94520 A0A6M4JKL3
Position
2951490..2951882
AA seq 130 aa
MFVMVLRIILLALFAYCIYAVVKYVANPKRRLKLAQSKEHFYIIDEQNNTRKNFQLTYKG
VLFEGEKHIPSKDHPLFIHTIFVWTESPEKLKHFSAKDFENIEEKVLERYPNCKIDWDQP
IKLAKKAEER
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtttgtcatggttctaaggattattttgcttgcactttttgcttattgtatttatgcc
gtggtcaaatatgtcgcgaatcctaagagaaggcttaagctggcccaatcaaaagaacat
ttttatattattgatgaacaaaacaatacccggaagaattttcagctgacgtataaaggc
gtgctttttgagggagaaaagcatattccttccaaggatcatccgctgtttattcacacg
atctttgtctggacagaatctcctgagaagctgaaacatttctctgcaaaagattttgag
aacattgaagaaaaagtgctggaacgatatccaaattgtaagattgactgggaccagccc
attaaactcgcaaaaaaagcagaagagcgttaa

DBGET integrated database retrieval system