KEGG   Bacillus subtilis subsp. subtilis 168: BSU28840
Entry
BSU28840          CDS       T00010                                 

Gene name
ysdA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1294 DUF1198 TauE PIG-Y
Other DBs
NCBI-GeneID: 937419
NCBI-ProteinID: NP_390762
Pasteur: BG12315
BSORF: BG12315
UniProt: P94519 A0A6M3ZFA5
Position
complement(2951898..2952167)
AA seq 89 aa
MIIAAYLVLINLCGFWVMGIDKRKAQQHKWRISEDRLWLIAIVFGALGVWLGMQTFRHKT
KHASFKYGVPLLLVIEAILIAIYYSPFDL
NT seq 270 nt   +upstreamnt  +downstreamnt
atgattattgctgcttatttggtgttgattaatctgtgcggtttttgggtgatgggcatt
gacaaacgcaaagcgcagcagcacaagtggagaatttctgaagaccggctgtggctgata
gccatcgtgtttggagcgctcggtgtctggcttggcatgcaaaccttcagacataaaacg
aaacacgcttcttttaagtacggagtaccgcttcttctggtaatagaagcgattctcatc
gctatttactacagcccgtttgatttataa

DBGET integrated database retrieval system