KEGG   Bacillus subtilis subsp. subtilis 168: BSU28860Help
Entry
BSU28860          CDS       T00010                                 

Gene name
rpmI
Definition
(RefSeq) 50S ribosomal protein L35
  KO
K02916  large subunit ribosomal protein L35
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU28860 (rpmI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU28860 (rpmI)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU28860 (rpmI)
  Bacteria
    BSU28860 (rpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L35p
Motif
Other DBs
NCBI-GeneID: 937421
NCBI-ProteinID: NP_390764
Pasteur: BG11972
BSORF: BG11972
UniProt: P55874
Position
complement(2952615..2952815)
Genome map
AA seq 66 aa AA seqDB search
MPKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVSAGDFKRIKQ
MLANIK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaatgaaaactcaccgcggatctgctaaacgttttaaaaagacaggttctggg
aagttaaaacgttctcacgcgtacacaagtcacttattcgccaacaaatctcaaaagcaa
aagcgtaagcttcgcaagagtgctgttgtaagcgcaggagacttcaaacgtatcaaacaa
atgcttgctaacatcaagtaa

DBGET integrated database retrieval system