KEGG   Bacillus subtilis subsp. subtilis 168: BSU28870
Entry
BSU28870          CDS       T00010                                 

Gene name
infC
Definition
(RefSeq) translation initiation factor IF-3
  KO
K02520  translation initiation factor IF-3
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU28870 (infC)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU28870 (infC)
Translation factors [BR:bsu03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    BSU28870 (infC)
 Prokaryotic type
   BSU28870 (infC)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BSU28870 (infC)
SSDB
Motif
Pfam: IF3_C IF3_N mIF3
Other DBs
NCBI-GeneID: 937835
NCBI-ProteinID: NP_390765
Pasteur: BG11944
BSORF: BG11944
UniProt: P55872 A0A6M3ZJ46
Position
complement(2952828..2953349)
AA seq 173 aa
MISKDQLVNEGIRAREVRLIGQNGDQLGIKSRQEALEIAGRANLDLVLVAANAKPPVCRI
MDYGKFRFEQQKKEKEARKNQKIINLKEVRLSPTIDEHDFNTKLRNAIKFLEKGDKVKAS
IRFKGRAITHKEIGQRVLDRFSEACAEVATVETKPKMDGRSMFLMLAPKNEKQ
NT seq 522 nt   +upstreamnt  +downstreamnt
attattagcaaagatcaattggttaatgagggtatccgtgcacgtgaggtccgtttaatc
ggacaaaatggcgaccagcttggaatcaagtcccgtcaggaagcacttgaaatcgccggc
cgcgcaaatcttgaccttgtgttagttgcagcgaatgcaaaaccgcctgtctgccgaatc
atggactacggtaagttccgatttgagcagcagaaaaaggaaaaagaagcacgcaagaat
caaaaaatcattaacttaaaagaagttcggttaagtccgacaatcgatgagcatgacttt
aacacgaaattgcgcaatgcgattaaattccttgaaaaaggcgataaagtgaaagcttct
atccgctttaaaggacgcgcaatcactcataaagaaatcggtcagcgtgtattagaccgt
ttctccgaagcatgtgctgaggttgcgacagtcgaaacaaaaccaaaaatggacggccgc
agcatgttcttaatgctcgcaccgaaaaacgaaaagcaataa

DBGET integrated database retrieval system