KEGG   Bacillus subtilis subsp. subtilis 168: BSU28890
Entry
BSU28890          CDS       T00010                                 

Gene name
yscB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-GeneID: 936599
NCBI-ProteinID: NP_390767
Pasteur: BG12314
BSORF: BG12314
UniProt: P94517 A0A6M4JKX3
Position
2953795..2954460
AA seq 221 aa
MNKLIQLALFFTLMLTGCSNSSTSSESKVETTVKTTAAFPQKELEKELKKLKPVSLDMKF
ESPLATELGKRKAKEEAEKQRQIAAEKKLEKEREAKRKKQQEEKAERQRLAEQQAAERQR
LAEAERQAELERQRQAAIQKEQKANAEKKRQSQAQRQQTEAPSSNSQDPPSSSSQTDKTI
QQPASELPDDDGYGYEERKKWHDDQVEWGIKQGYIDPEDAP
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaacaaactgatacagcttgctttatttttcacattgatgttaaccggttgctcgaat
agcagcacatcttccgaatcaaaagtcgaaaccactgttaagacaacggcagcatttcct
caaaaggagctggagaaagagctaaaaaaactaaaacccgtttcattggacatgaagttc
gagagtccactcgctaccgagttaggaaagcggaaggcaaaagaggaagctgaaaagcaa
agacaaatcgccgctgagaaaaagcttgaaaaagagcgggaggcgaaacgaaagaaacag
caggaggaaaaagcggagagacagcgattagcagagcagcaggctgcagagagacagcga
ttagccgaagcggaaagacaagctgaacttgaaagacagcggcaggcagcaatccaaaaa
gagcagaaagcgaacgctgagaaaaagcggcaatcgcaggcacaacggcagcagactgag
gcaccctcatctaatagtcaagatccaccatcttcctcgagtcagacagataaaaccatt
caacagccagcttcagagcttcctgatgacgatggttatggttatgaagaacgaaaaaag
tggcatgacgatcaagtagaatggggcattaaacaagggtatatcgatcccgaagacgca
ccataa

DBGET integrated database retrieval system