KEGG   Bacillus subtilis subsp. subtilis 168: BSU28900
Entry
BSU28900          CDS       T00010                                 

Gene name
ysbB
Definition
(RefSeq) antiholin-like protein LrgB
  KO
K05339  holin-like protein LrgB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU28900 (ysbB)
SSDB
Motif
Pfam: LrgB
Other DBs
NCBI-GeneID: 937418
NCBI-ProteinID: NP_390768
Pasteur: BG12312
BSORF: BG12312
UniProt: P94516 A0A6M4JM20
Position
complement(2954492..2955187)
AA seq 231 aa
MESTMSPYFGIVVSLAAFGIGTFLFKKTKGFFLFTPLFVAMVLGIAFLKIGGFSYADYNN
GGEIIKFFLEPATIAFAIPLYKQRDKLKKYWWQIMASIIAGSICSVTIVYLLAKGIHLDS
AVMKSMLPQAATTAIALPLSKGIGGISDITAFAVIFNAVIVYALGALFLKVFKVKNPISK
GLALGTSGHALGVAVGIEMGEVEAAMASIAVVVVGVVTVLVIPVFVQLIGG
NT seq 696 nt   +upstreamnt  +downstreamnt
atggaaagcacaatgagtccttattttgggattgtcgtatcacttgctgcattcggcatc
ggcacctttttatttaagaaaacgaaaggcttcttccttttcactcctttgtttgttgcc
atggtgctggggatcgcatttttaaaaatcggcggtttttcctacgcggattataataac
gggggagagatcattaagttttttcttgaaccggcaacgatcgcatttgcaattcctttg
tacaaacaaagagataagcttaaaaagtactggtggcaaatcatggcctccattattgcc
ggctctatctgctctgtcacgattgtttatctgctcgctaaaggcattcatctcgattcg
gccgtaatgaaaagcatgcttccgcaggcggctacaacggcaattgcgcttcctttatca
aaaggcatcgggggcatcagcgacatcacagcctttgcggtcatctttaacgctgtcatc
gtatatgcgctcggagcattgttcttgaaggtgtttaaagtgaaaaatccgatttctaaa
ggattggctcttggaacatccggacatgcacttggtgtagcggtcgggattgagatggga
gaagttgaagctgcgatggcaagtattgctgttgtcgtagtaggagtggtaacggttctg
gtcatccctgtgttcgtgcagctgatcggaggataa

DBGET integrated database retrieval system