KEGG   Bacillus subtilis subsp. subtilis 168: BSU28910
Entry
BSU28910          CDS       T00010                                 

Symbol
ysbA
Name
(RefSeq) antiholin-like protein LrgA
  KO
K05338  holin-like protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU28910 (ysbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU28910 (ysbA)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU28910 (ysbA)
SSDB
Motif
Pfam: LrgA DUF6524
Other DBs
NCBI-GeneID: 937417
NCBI-ProteinID: NP_390769
Pasteur: BG12311
BSORF: BG12311
UniProt: P94515 A0A6M4JMJ5
Position
complement(2955209..2955649)
AA seq 146 aa
MSAKKVYGFLTQAFIFAVIMLVSNMIAAIVPIPIPASVVGLVLLFLLLCLKVIKLEQVET
LGTSLTSLIGFLFVPSGISVMNSLGVMQQYGLQIVLVILLATIILLGATGLFSQLILSLS
GKRKTEADMKTKTVQSPQNNNELVHH
NT seq 441 nt   +upstreamnt  +downstreamnt
atgagtgctaaaaaagtgtacgggtttttaacacaagcatttatttttgccgtcattatg
ctggtttcaaatatgattgccgctattgtcccaatacctatcccggcatcggttgtaggg
ttggtcttattatttctcctattatgtttgaaagtcattaaactggaacaagtggagacg
ctcggaacgtctttaacctctctgatcggatttttatttgttccatcaggtatatctgtt
atgaattcgcttggtgtgatgcagcaatacggcctgcaaattgttcttgtcattctgctc
gcaacgattattttgctgggggctacgggattgttttctcagctgattctgtcgctgagc
ggaaaacgcaaaaccgaagcggacatgaaaacaaaaacagtgcaaagcccgcagaacaat
aacgaactcgttcaccattaa

DBGET integrated database retrieval system