KEGG   Bacillus subtilis subsp. subtilis 168: BSU28920
Entry
BSU28920          CDS       T00010                                 

Symbol
lytT
Name
(RefSeq) sensory transduction protein LytT
  KO
K07705  two-component system, LytTR family, response regulator LytT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU28920 (lytT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU28920 (lytT)
Two-component system [BR:bsu02022]
 LytTR family
  LysS-LysR
   BSU28920 (lytT)
SSDB
Motif
Pfam: LytTR Response_reg cREC_REC
Other DBs
NCBI-GeneID: 936931
NCBI-ProteinID: NP_390770
Pasteur: BG11953
BSORF: BG11953
UniProt: P94514 A0A6M3ZFA0
Position
complement(2955783..2956508)
AA seq 241 aa
MLRVLIVDDEMLARDELAYLLKRTNDEMEINEAENIESAFDQMMDQKPDLLFLDVDLSGE
NGFDIAKRLKKMKHPPAIVFATAYDQYALKAFEVDALDYLTKPFDEERIQQTLKKYKKVN
RDIVETEQNSHAGQHKLALSVGESIVIVDTKDIIYAGTEDGHVNVKTFDHSYTVSDTLVV
IEKKLPDSDFIRVHRSFVVNTEYIKEIQPWFNSTYNLIMKDGSKIPVSRTYAKELKKLLH
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgctcagggtgttaatagttgatgatgagatgctggcaagggatgaactggcttacttg
cttaagcggaccaatgatgaaatggaaatcaatgaagcggaaaatatcgaatccgctttt
gaccaaatgatggatcaaaaacctgatttgctgtttttagacgttgatttatccggagaa
aacggttttgatatcgcaaagcgattgaagaaaatgaagcatcctcctgctattgtgttt
gcgacagcgtatgaccagtatgcgctcaaagcgtttgaggtggacgctcttgattattta
accaagcctttcgatgaagaaagaattcagcaaacgctgaaaaaatataaaaaagtcaat
cgggatattgtagaaacagagcaaaacagccatgccggccagcacaagctcgcgctatct
gtgggggaatcgattgtgattgtggatacgaaggacattatctatgccggaacagaagat
ggtcatgtcaatgtaaaaaccttcgatcattcttatacggtcagcgatacactcgttgtg
attgagaaaaagctgccggattctgattttatccgcgtccatcggagctttgtcgtgaat
actgaatatattaaagaaattcagccatggtttaattcaacgtataatctgatcatgaaa
gacggatcgaaaataccggtcagccggacatatgcgaaggaattgaaaaagctgctccat
atttga

DBGET integrated database retrieval system