KEGG   Bacillus subtilis subsp. subtilis 168: BSU28930
Entry
BSU28930          CDS       T00010                                 

Gene name
lytS
Definition
(RefSeq) sensor protein LytS
  KO
K07704  two-component system, LytTR family, sensor histidine kinase LytS [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU28930 (lytS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU28930 (lytS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU28930 (lytS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU28930 (lytS)
Protein kinases [BR:bsu01001]
 Histidine kinases
  LytTR family [OT]
   BSU28930 (lytS)
Two-component system [BR:bsu02022]
 LytTR family
  LysS-LysR
   BSU28930 (lytS)
SSDB
Motif
Pfam: 5TM-5TMR_LYT His_kinase HATPase_c GAF_3 GAF GAF_2 HATPase_c_2
Other DBs
NCBI-GeneID: 937404
NCBI-ProteinID: NP_390771
Pasteur: BG11952
BSORF: BG11952
UniProt: P94513 A0A6M3ZJW2
Position
complement(2956486..2958267)
AA seq 593 aa
MIHLMIMMLERVGIIVILGFILAHTKLFRQALQNQDGYKGKAILISIFSLFSIISNYTGI
EIQRNMIVNNDWVFTIDPSGSIANTRILGVEIGGLLGGPFVGAGIGILAGLHRFSLGGST
ALSCAVSSILAGVLAGLIGRYFTKRYRMPTPRIAALVGIGMESLQMIIILLMAKPFSDAW
ELVSMIGIPMILINGTGSFIFLSIIQAIIRKEEQARALETHRVLTIADQTLPFFRQGLNE
NSCKSVAAIIHKLTGTDAVSLTDKEKILAHVGAGMDHHIPSKSLITGLSKKVIKTGHIMK
AISQEEIECTHAECPLHAAIVLPLTSNGNTIGTLKMYFKSPAGLSQVEEELAEGLAMLFS
TQLELGEAELQSKLLKDAEIKALQAQVNPHFLFNAINTISALCRTDVEKTRKLLLQLSVY
FRSNLQGARQLLIPLSKELNHLNAYLSLEQARFPGKYKIELNIDSRLEQIEIPPFVLQVL
VENALRHAFPKKQDICKVTVCVLSDDASVYMKVADNGRGIPPDVLPELGKKPFPSKEGTG
TALYNLNQRLIGLFGQQAALHISSEVHKGTEVSFQVPMQQMKEGEEHAQGVNS
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgattcatttaatgattatgatgctggagagagtggggattattgttatattagggttc
attctcgcccatacgaaacttttcagacaagctcttcagaatcaggacggctataaagga
aaagcgattttaatttctattttttctcttttcagcatcatcagcaattatacaggcatc
gaaattcaaagaaatatgattgtaaacaatgactgggtgtttacgatagatccatcgggc
tctatcgcgaatacccgtattttgggcgtggaaatcgggggccttctcggaggtcctttt
gtaggggctgggatcggcatacttgcgggcctgcatcgtttttcactcggtggcagcacg
gccttaagctgtgccgtctcatctattttagcgggtgttcttgcaggcttgatcggcagg
tattttacgaagcgatatcgaatgccgacaccgcgcatcgccgctcttgtgggaatcggc
atggagtcactgcaaatgatcattattttgctgatggcaaagccgttcagtgacgcttgg
gagcttgtcagcatgatcggaattccgatgatactcatcaatggaacaggcagttttatt
tttctgtctattattcaagcgatcattcgcaaggaagaacaggcaagggctctcgaaacg
catcgagtgcttacgattgctgatcagacacttccatttttccgccaaggattaaatgaa
aactcctgtaaaagtgtagcggctattatccataagctgacaggaacagatgcggtgtct
ctcactgacaaagaaaagatccttgcgcatgtcggtgcgggaatggatcaccacatccca
tcgaaaagcttgatcaccggcctgtccaaaaaggtgattaaaacagggcatattatgaag
gcgatttcgcaggaagagattgaatgcacgcatgctgaatgccctttgcacgctgcaatt
gtcctaccgctgacatcgaacggcaatacaatcggcaccttaaaaatgtactttaaaagc
ccggcaggcctgagtcaggtagaggaggaacttgccgaggggctggccatgctgttttcg
acacagcttgagcttggggaagcagagctgcaaagcaaacttctcaaggatgctgaaatt
aaagcgcttcaagcacaggtgaatccgcattttttatttaatgcgatcaacacgatttct
gcgttatgccgtacagatgttgaaaaaacccgtaagctcctattgcagctcagtgtttat
tttcgttcaaaccttcaaggagcgagacagctgctgattccgctctcaaaggagctgaac
catcttaacgcctatttgtcattagaacaggcgcgttttcccgggaaatataaaattgag
cttaatatcgacagcagactggagcagattgaaatccctccgtttgttttgcaggtgctt
gtcgagaacgcgcttcggcacgcgtttccgaaaaaacaagacatatgcaaggttacagtc
tgtgtcttatctgatgatgcatccgtctatatgaaggtggcggataacggacgcggaatt
ccgccggacgtcttgccggaactggggaagaaaccgtttccgtctaaggagggaaccggt
acagcgctttataacctaaatcagcggctgatcggtttattcggacagcaggctgcactg
catatcagcagtgaggttcataaagggacagaggtttcctttcaagtgccaatgcaacag
atgaaagagggagaagaacatgctcagggtgttaatagttga

DBGET integrated database retrieval system