KEGG   Bacillus subtilis subsp. subtilis 168: BSU28940
Entry
BSU28940          CDS       T00010                                 

Symbol
ysaA
Name
(RefSeq) hydrolase YsaA
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU28940 (ysaA)
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PGP_phosphatase Hydrolase_3
Other DBs
NCBI-GeneID: 936546
NCBI-ProteinID: NP_390772
Pasteur: BG12310
BSORF: BG12310
UniProt: P94512 A0A6M4JN09
Position
2958434..2959216
AA seq 260 aa
MKAVFFDLDDTLLWDEKSVRTTFAETCLQAEKKYGLAPEEFEAAVREAARELYMSYETYP
YTVMIGINPFEGLWSNFSEPISEGFQKLNKIVPEYRRNAWTNGLKALGIDDPAYGEYLGE
FFAAERRKRPFVYDETFAVLDQLKGKYELLLLTNGDPSLQKEKLAGVPELAPYFNEIVIS
GAFGKGKPDVSIFEHCLKLMNIEKDDAIMVGDNLNTDILGASRAGIKTVWINRTDKKNET
DVKPDYIISSLHDLFPILEK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaaagccgtattttttgatttagatgatacactactttgggacgaaaaaagcgtcaga
acaacatttgcagaaacttgcttacaggcggagaaaaaatatggccttgcccctgaggaa
ttcgaagcagctgttcgcgaagcggcgagagaattgtacatgtcatatgagacgtatcca
tatacagtgatgatcggcattaacccgtttgaaggactgtggtccaatttctcagagcca
atcagtgaaggctttcaaaagctgaacaagattgtgccggagtacagaagaaatgcatgg
accaacggactgaaagcgcttgggatcgatgatcctgcatatggcgaatacttgggagag
ttttttgcggcagagcgcagaaagcgcccgtttgtatatgatgaaacttttgctgtactc
gatcaattaaaaggcaagtatgaattattgcttttgacaaatggcgatcctagtctgcaa
aaggagaagcttgccggcgtgcctgagctcgctccttacttcaatgaaatcgtcatctcg
ggcgcattcggcaagggcaagccggatgtttcaatttttgaacactgccttaagctgatg
aatattgaaaaagacgatgccatcatggtcggcgataatttgaatactgatattttaggc
gcttcaagagccggaatcaaaaccgtttggatcaaccggactgataagaaaaacgaaact
gacgtaaagcctgattacatcatcagcagccttcatgatttgtttcctatattagagaaa
taa

DBGET integrated database retrieval system