KEGG   Bacillus subtilis subsp. subtilis 168: BSU28960
Entry
BSU28960          CDS       T00010                                 

Gene name
ytxC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YtxC
Other DBs
NCBI-GeneID: 937401
NCBI-ProteinID: NP_390774
Pasteur: BG10361
BSORF: BG10361
UniProt: P06569 A0A6M3ZFB3
Position
complement(2961586..2962431)
AA seq 281 aa
MLEIIFEDDHDAAAFLHLIQHSDDRNNIIVREGIRKIGIEKANPAFPIQRFMEPILVKFF
LECKEDEHMLSLIEETYCFTDQDEQQQILQLAHSIIEGEADDLPFEPLKLSRKQSILDEL
QTICLEEGVFYIRSFQTFRLGSYYKQLRDITEAAIDEYKMEQEYQNFIQTLRDYVDAKQP
RIKKVHIVHDGSFTLWELRYVPEREKMKYIDRRFVRDHPMYIDSHLLAPLISIAPDEVVL
YTDQPEHMMARTIQNVFQERVEMLPLHAFTDAEIPVKHSEG
NT seq 846 nt   +upstreamnt  +downstreamnt
atgcttgaaataatctttgaagatgaccatgatgcagccgcttttttacatctcattcag
cattcggacgatcggaacaatatcattgtccgtgaaggcatacgaaaaatcgggattgaa
aaagcgaatccggcttttcctattcagcgttttatggagccgattctggtcaaatttttt
ttggaatgcaaagaagacgagcatatgctgtcattgattgaggaaacgtattgtttcacg
gaccaggatgaacagcagcaaatccttcagctcgcacacagtattattgaaggtgaagca
gacgatcttccgtttgagccgctgaagctttcacggaaacaatcaattttggatgaactc
caaacgatctgtttagaggaaggagtattttacattcgctcctttcagaccttccgactt
ggatcatactataagcagctgagagatattacagaagcagcgattgatgaatataagatg
gaacaggaatatcaaaactttattcaaacactcagagactatgtggacgccaaacagccg
cgaatcaaaaaagtgcatattgtccatgatggttcctttacattatgggagctgcgctat
gtgccggaacgggaaaaaatgaaatacatagacagaagatttgtccgggatcatcctatg
tatattgattctcatttgctcgcgccgctgatttccattgcgcctgatgaagtcgtgctt
tataccgaccagcccgagcacatgatggcaaggaccattcaaaacgtatttcaagagaga
gtggaaatgctcccgctgcatgcttttacagatgcagaaataccggtgaagcactcggaa
ggatga

DBGET integrated database retrieval system