KEGG   Bacillus subtilis subsp. subtilis 168: BSU28970
Entry
BSU28970          CDS       T00010                                 

Symbol
ytxB
Name
(RefSeq) tvp38/tmem64 family membrane protein YtxB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SNARE_assoc
Other DBs
NCBI-GeneID: 937403
NCBI-ProteinID: NP_390775
Pasteur: BG10360
BSORF: BG10360
UniProt: P06568 A0A6M3ZFC2
Position
complement(2962510..2963151)
AA seq 213 aa
MKRKTAVKWLAVLAGAGLLYWGNKTYLNVSPKEIRVWVLSFGVFAPLMFIGISIVRPLVL
FPVSVISIAGGLAFGPLLGTLYTLFGSMCASAVSFFAAGLFSAKKNGHYERLEAIQKQME
DNGFFYIFLLRILPINFDFVSYAAGLSNVKALPYFAATAVGIIPGTIALNVLGASFLAGN
LPAFFMVLALYIVFISLPFIFRKKMQNLFQESN
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaaacgaaaaacggctgtcaaatggctggcagtgcttgcaggtgctggtttactctat
tggggaaataaaacgtatttgaatgtatcgccgaaagaaatcagggtatgggtattgtcg
ttcggagtctttgcacctctgatgtttatcgggatatccatcgtcaggccacttgtttta
tttccggtgtctgttatttcaatagctggcggacttgcgtttggcccgcttctcggcacg
ctttatacgttattcggttcgatgtgcgcttcagctgtttcgttttttgcggctggtttg
ttttcggcgaaaaagaacgggcattacgaaaggcttgaagccatacagaagcaaatggag
gataacggatttttctatatctttcttttgagaatcctgccgatcaattttgatttcgtc
agctatgcggcaggcctttccaatgtcaaagcgctgccgtattttgccgcaacggctgtg
ggaatcatccctgggacgattgcgcttaatgtgctgggtgcgagctttttggctggcaat
ctgcccgctttctttatggtgctcgctttgtatatcgtgtttatctcattgccgttcatc
ttcagaaagaaaatgcaaaacttgttccaagaatcaaattaa

DBGET integrated database retrieval system