KEGG   Bacillus subtilis subsp. subtilis 168: BSU29000Help
Entry
BSU29000          CDS       T00010                                 

Gene name
nrdR
Definition
(RefSeq) transcriptional repressor NrdR
  KO
K07738  transcriptional repressor NrdR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU29000 (nrdR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU29000 (nrdR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-cone zf-ZPR1 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 937402
NCBI-ProteinID: NP_390778
Pasteur: BG13833
BSORF: BG13833
UniProt: Q45549
Position
complement(2965681..2966139)
Genome map
AA seq 152 aa AA seqDB search
MKCPSCQHNGTRVLDSRPVDDGKSIRRRRECESCHYRFTTFEKVEETPLIVVKKEGVREE
FSREKMLRGLIKACEKRPVSLKTLEDMCFDIEKELRNQGCSEVKSELVGEMVMDRLAKID
EVAYVRFASVYRQFKDINVFIDELKDLIKKER
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatgtccttcatgccagcataacggaacacgagtccttgattcacggcctgtggat
gacggaaagtcgattcgccgaagacgcgagtgcgaatcctgccactaccggtttacgacc
tttgagaaagtggaggaaaccccgctcatcgttgtgaaaaaagaaggtgtgcgtgaggaa
ttcagcagagaaaaaatgctgcgcggcctcataaaagcatgtgaaaaaaggcctgtttca
ctcaaaacgcttgaagacatgtgctttgatattgaaaaagaacttcgcaatcaaggctgc
tccgaggtgaagagtgagctcgtcggagaaatggtcatggaccggctggctaagattgac
gaagtcgcatatgtgcggttcgcgtccgtctatcggcagtttaaagatataaacgtcttt
atcgatgaattaaaagacttaataaagaaagagcgttaa

DBGET integrated database retrieval system