KEGG   Bacillus subtilis subsp. subtilis 168: BSU29010
Entry
BSU29010          CDS       T00010                                 

Symbol
speD
Name
(RefSeq) S-adenosylmethionine decarboxylase proenzyme
  KO
K01611  S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
bsu_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU29010 (speD)
   00330 Arginine and proline metabolism
    BSU29010 (speD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     BSU29010 (speD)
SSDB
Motif
Pfam: AdoMet_dc Toprim_3
Other DBs
NCBI-GeneID: 936773
NCBI-ProteinID: NP_390779
Pasteur: BG13832
BSORF: BG13832
UniProt: O34426 A0A6M3ZI96
Position
complement(2966413..2966793)
AA seq 126 aa
METMGRHVISELWGCDFDKLNDMDFIEKTFVNAALKSGAEVREVAFHKFAPQGVSGVVII
SESHLTIHSFPEHGYASIDVYTCGDLDPNVAADYIAEALHADTRENIEIPRGMGPVQIKQ
AQAKVL
NT seq 381 nt   +upstreamnt  +downstreamnt
atggaaacaatggggcgtcacgttatctccgagctatggggatgcgattttgataagctg
aatgacatggattttattgaaaaaacgtttgtaaatgctgctctaaaatcaggtgctgag
gtgcgcgaggttgcatttcacaaatttgcaccgcaaggcgtaagcggagttgtgattatt
tctgaatcacacttaacgattcacagttttcctgagcacggatatgcgagcattgatgtt
tatacttgtggagacttagatcctaatgtcgctgctgattacattgcagaggcattacat
gctgatacaagagaaaacattgaaataccaagaggaatggggcctgtgcaaattaaacag
gcgcaagcgaaagtactataa

DBGET integrated database retrieval system