KEGG   Bacillus subtilis subsp. subtilis 168: BSU29020
Entry
BSU29020          CDS       T00010                                 

Gene name
gapB
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase 2
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00002  Glycolysis, core module involving three-carbon compounds
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU29020 (gapB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bsu04131]
    BSU29020 (gapB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU29020 (gapB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     BSU29020 (gapB)
Membrane trafficking [BR:bsu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BSU29020 (gapB)
Exosome [BR:bsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BSU29020 (gapB)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N
Other DBs
NCBI-GeneID: 937393
NCBI-ProteinID: NP_390780
Pasteur: BG12592
BSORF: BG12592
UniProt: O34425 A0A6M4JMC6
Position
complement(2967032..2968054)
AA seq 340 aa
MKVKVAINGFGRIGRMVFRKAMLDDQIQVVAINASYSAETLAHLIKYDTIHGRYDKEVVA
GEDSLIVNGKKVLLLNSRDPKQLPWREYDIDIVVEATGKFNAKDKAMGHIEAGAKKVILT
APGKNEDVTIVMGVNEDQFDAERHVIISNASCTTNCLAPVVKVLDEEFGIESGLMTTVHA
YTNDQKNIDNPHKDLRRARACGESIIPTTTGAAKALSLVLPHLKGKLHGLALRVPVPNVS
LVDLVVDLKTDVTAEEVNEAFKRAAKTSMYGVLDYSDEPLVSTDYNTNPHSAVIDGLTTM
VMEDRKVKVLAWYDNEWGYSCRVVDLIRHVAARMKHPSAV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaaggtaaaagtagcgatcaacgggtttggaagaatcggaagaatggtttttagaaaa
gcgatgttagacgatcaaattcaagtagtggccattaacgccagctattccgcagaaacg
ctggctcatttaataaagtatgacacaattcacggcagatacgacaaagaggttgtggct
ggtgaagatagcctgatcgtaaatggaaagaaagtgcttttgttaaacagccgtgatcca
aaacagctgccttggcgggaatatgatattgacatagtcgtcgaagcaacagggaagttt
aatgctaaagataaagcgatgggccatatagaagcaggtgcaaaaaaagtgattttgacc
gctccgggaaaaaatgaagacgttaccattgtgatgggcgtaaatgaggaccaattcgac
gctgagcgccatgtcattatttcaaatgcgtcatgcacgacaaattgccttgcgcctgtt
gtaaaagtgctggatgaagagtttggcattgagagcggtctgatgactacagttcatgcg
tatacgaatgaccaaaaaaatattgataacccgcacaaagatttgcgccgggcgcgggct
tgcggtgaatccatcattccaacaacaacaggagcggcaaaggcgctttcgcttgtgctg
ccgcatctgaaaggaaaacttcacggcctcgccttgcgtgtccctgttccgaacgtctca
ttggttgatctcgttgttgatctgaaaacggatgttacggctgaagaagtaaacgaggca
tttaaacgcgctgccaaaacgtcgatgtacggtgtacttgattactcagatgaaccgctc
gtttcgactgattataatacgaatccgcattcagcggtcattgacgggcttacaacaatg
gtaatggaagacaggaaagtaaaggtgctggcgtggtatgacaacgaatggggctactcc
tgcagagttgttgatctaatccgccatgtagcggcacgaatgaaacatccgtctgctgta
taa

DBGET integrated database retrieval system