KEGG   Bacillus subtilis subsp. subtilis 168: BSU29030
Entry
BSU29030          CDS       T00010                                 

Gene name
ytcD
Definition
(RefSeq) HxlR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HxlR MarR ISAV_HA
Other DBs
NCBI-GeneID: 936607
NCBI-ProteinID: NP_390781
Pasteur: BG13831
BSORF: BG13831
UniProt: O34533 A0A6M3ZJW9
Structure
PDB: 
2HZT

Position
complement(2968260..2968640)
AA seq 126 aa
MEKKKYNISVEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMPNITQKMLTQQLRELEA
DGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINRVYGDTFSVLEESVLND
KLKQES
NT seq 381 nt   +upstreamnt  +downstreamnt
atggagaagaaaaaatataacatttctgttgaagcgactcttgaagtgatcggtgggaaa
tggaaatgcgtcattttatgccatctgacgcacggaaaaaaacgcacaagtgaattaaaa
cgcctaatgcccaatatcacgcaaaaaatgctgactcagcagctgcgcgagctggaagcg
gacggtgtcattaaccgaatcgtatataatcaagttcctcccaaagtggaatacgagctc
agcgaatacggccgcagcttagaagggattttagatatgctgtgtgcttggggagcgaat
catattaacagagtgtacggggatacattttctgtgctagaagaaagtgtgctcaatgat
aagttaaaacaggaatcataa

DBGET integrated database retrieval system