KEGG   Bacillus subtilis subsp. subtilis 168: BSU29070Help
Entry
BSU29070          CDS       T00010                                 

Gene name
ytaF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mntp
Motif
Other DBs
NCBI-GeneID: 937389
NCBI-ProteinID: NP_390785
Pasteur: BG13823
BSORF: BG13823
UniProt: C0SP79
Position
complement(2971531..2972163)
Genome map
AA seq 210 aa AA seqDB search
MQMVSILLLALAVSLDSFSVGFTYGLRKMKIPFKAILVIACCSGAVMFISMLIGSFLTKF
FPVYVTEKLGGLILVGIGAWVLYQFFKPAKDKEYLLHEKTLLNLEVRSLGIVIHILRKPM
SADIDKSGVINGIEAVLLGFALSIDAFGAGIGAAILGFSPIVMSIAVAIMSSLFVSIGIN
AGHFLSKWKWIDKMAFLPGLLLITIGLWKL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatggtttctatactgctgctggcgttggctgtcagcttggacagtttttcagtc
ggatttacgtacggattgagaaaaatgaaaataccgtttaaagcgattttggttatcgcc
tgctgttccggtgctgtcatgtttatatccatgctgatcggaagctttctcacgaagttt
tttcctgtatatgtgacggagaagcttggcggtttgatattggttggaatcggtgcgtgg
gttctgtatcaatttttcaaaccggcaaaagataaagaatacctattgcatgaaaaaaca
ctgcttaatctagaggttcggtcattaggaattgtgattcatattttgagaaaacccatg
agtgcggatatcgacaaatcgggtgtgatcaacggaattgaggcggtcttattgggattt
gccttatcgattgatgcctttggagcaggtataggcgcagccattctcggtttttcgccg
attgtgatgagcatcgccgtggcaatcatgagctcgctgtttgtatcaattggaatcaat
gccggccattttctgtctaagtggaaatggatcgataaaatggcgtttttgccggggctt
ctattaatcacgattgggctctggaaattgtaa

DBGET integrated database retrieval system