KEGG   Bacillus subtilis subsp. subtilis 168: BSU29090Help
Entry
BSU29090          CDS       T00010                                 

Gene name
polA
Definition
(RefSeq) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
bsu03410  Base excision repair
bsu03420  Nucleotide excision repair
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU29090 (polA)
   03410 Base excision repair
    BSU29090 (polA)
   03420 Nucleotide excision repair
    BSU29090 (polA)
   03440 Homologous recombination
    BSU29090 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU29090 (polA)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU29090 (polA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSU29090 (polA)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     BSU29090 (polA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     BSU29090 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU29090 (polA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc HHH_5 HHH_2 UBA_3 HHH
Motif
Other DBs
NCBI-GeneID: 936617
NCBI-ProteinID: NP_390787
Pasteur: BG12656
BSORF: BG12656
UniProt: O34996
Position
complement(2973182..2975824)
Genome map
AA seq 880 aa AA seqDB search
MTERKKLVLVDGNSLAYRAFFALPLLSNDKGVHTNAVYGFAMILMKMLEDEKPTHMLVAF
DAGKTTFRHGTFKEYKGGRQKTPPELSEQMPFIRELLDAYQISRYELEQYEADDIIGTLA
KSAEKDGFEVKVFSGDKDLTQLATDKTTVAITRKGITDVEFYTPEHVKEKYGLTPEQIID
MKGLMGDSSDNIPGVPGVGEKTAIKLLKQFDSVEKLLESIDEVSGKKLKEKLEEFKDQAL
MSKELATIMTDAPIEVSVSGLEYQGFNREQVIAIFKDLGFNTLLERLGEDSAEAEQDQSL
EDINVKTVTDVTSDILVSPSAFVVEQIGDNYHEEPILGFSIVNETGAYFIPKDIAVESEV
FKEWVENDEQKKWVFDSKRAVVALRWQGIELKGAEFDTLLAAYIINPGNSYDDVASVAKD
YGLHIVSSDESVYGKGAKRAVPSEDVLSEHLGRKALAIQSLREKLVQELENNDQLELFEE
LEMPLALILGEMESTGVKVDVDRLKRMGEELGAKLKEYEEKIHEIAGEPFNINSPKQLGV
ILFEKIGLPVVKKTKTGYSTSADVLEKLADKHDIVDYILQYRQIGKLQSTYIEGLLKVTR
PDSHKVHTRFNQALTQTGRLSSTDPNLQNIPIRLEEGRKIRQAFVPSEKDWLIFAADYSQ
IELRVLAHISKDENLIEAFTNDMDIHTKTAMDVFHVAKDEVTSAMRRQAKAVNFGIVYGI
SDYGLSQNLGITRKEAGAFIDRYLESFQGVKAYMEDSVQEAKQKGYVTTLMHRRRYIPEL
TSRNFNIRSFAERTAMNTPIQGSAADIIKKAMIDMAAKLKEKQLKARLLLQVHDELIFEA
PKEEIEILEKLVPEVMEHALALDVPLKVDFASGPSWYDAK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacgaaaaaaattagtgcttgtagacggaaacagtctggcttaccgggcgttt
tttgcattgccgctgttaagcaatgataaaggtgttcatacgaatgctgtatacggcttt
gcgatgattttgatgaaaatgcttgaggatgaaaaaccgacgcacatgctggttgcgttt
gatgccgggaaaacaacatttcgtcacggcacatttaaagaatataaaggcggcagacag
aaaaccccgcctgagctttccgaacaaatgccgtttatccgcgagctgctggatgcctac
cagatcagccgctatgaactggaacaatatgaagcggatgatattatcggcacactggcc
aaatcggctgaaaaagacggatttgaagttaaggttttctcaggagataaggatttaacc
cagctggcaacggacaaaacgacagttgccattacgagaaagggaattaccgatgttgaa
ttttacacaccggagcatgtcaaagagaaatatgggcttacgcctgaacaaatcattgac
atgaagggtctgatgggcgattcctcagataatattccgggtgtgcccggcgtcggagaa
aagactgcgattaagcttttaaaacaatttgattccgttgaaaagctgctggagtccatt
gacgaggtgagcggaaagaaattgaaggaaaagcttgaggagtttaaggatcaggcattg
atgagcaaggagcttgcgacaattatgacggatgctccgattgaggtatctgtttccggc
ctggaatatcaaggctttaatcgtgaacaggtcattgccatctttaaagatcttggcttc
aacacgcttcttgaacggcttggagaagacagtgcagaagcagaacaggatcaatcgttg
gaagacattaatgtcaaaacagtcacagacgtgacaagcgatatattggtttctccatcc
gcatttgtcgttgaacagattggcgataattatcatgaagagccgatcctcggattttcg
atcgtaaatgaaacgggagcttatttcattccgaaagacattgccgttgagtctgaggtg
tttaaagaatgggtggaaaatgacgagcagaagaaatgggtcttcgacagcaagcgggcc
gttgtcgctttgcgctggcagggcattgagctgaaaggagccgagtttgatacgctcctt
gcggcttatatcatcaacccgggcaattcatatgacgacgttgcgagtgtggctaaggat
tacggcctgcatatcgtttcaagtgatgaatcagtttatggaaaaggagcaaaacgggca
gtgccgtcagaagacgtactgtctgagcaccttggccgaaaagcgttagcgattcaaagc
cttcgggaaaagctcgttcaagagctggaaaacaacgaccagcttgaactgtttgaagag
ctggaaatgcctcttgcgcttattcttggcgaaatggaatcaactggcgtcaaggtcgat
gttgaccgtttaaaacggatgggtgaagaactgggtgcgaagctgaaggaatatgaagaa
aaaatccatgagattgcgggagagccgtttaacatcaattctccgaaacagctaggcgtc
atcttatttgaaaagatcggccttcctgtcgtaaagaaaacgaaaacaggctattctacg
tctgccgatgtgcttgaaaagctggctgacaagcatgatattgtcgactatattttacag
tacagacaaattggcaagcttcaatcaacatatatcgaagggcttttaaaggtgacgaga
ccggattcgcataaagtgcacacgcgatttaaccaggccttaacgcaaactggccgtctc
agctcgactgatccgaacctgcaaaacattccgatcaggcttgaggaagggcggaaaatt
cgccaagcttttgtgccgtctgaaaaagactggctcatttttgcagccgattattcacaa
atcgagctgcgggtgcttgcccatatttcaaaggatgaaaatctgatcgaagcttttact
aatgatatggatattcacacgaaaacggcaatggatgtgttccatgtcgctaaggatgaa
gtgacatctgcgatgagacgccaggcgaaagcggtcaactttggcattgtttacgggatc
agcgattacggtctgtcacagaacctcggcattacccggaaggaagcgggagcatttatc
gaccgctatctggaaagcttccaaggcgtaaaagcgtacatggaagattcagtacaggaa
gcgaaacaaaaaggatacgtaacaacgcttatgcatcgccgccgctacatccctgagctg
acgagccggaactttaatatccgaagttttgcggagcggacggccatgaatacgccgatt
caaggaagcgccgctgatattatcaaaaaagccatgattgacatggctgccaagctgaaa
gaaaaacagttgaaagcaaggcttctgcttcaagtacacgatgaattgatttttgaggcg
ccaaaggaagaaattgaaattcttgaaaagcttgttcctgaagtgatggagcatgcgctt
gcattagatgtgccgttaaaggtggactttgcatcaggcccatcttggtacgatgcgaaa
taa

DBGET integrated database retrieval system