KEGG   Bacillus subtilis subsp. subtilis 168: BSU29120
Entry
BSU29120          CDS       T00010                                 

Symbol
mdh
Name
(RefSeq) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00270  Cysteine and methionine metabolism
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU29120 (mdh)
   00620 Pyruvate metabolism
    BSU29120 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU29120 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU29120 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU29120 (mdh)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BSU29120 (mdh)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 UDPG_MGDP_dh_N DAO NAD_binding_8 3HCDH_N Pyr_redox_2 MAP7
Other DBs
NCBI-GeneID: 937385
NCBI-ProteinID: NP_390790
Pasteur: BG11386
BSORF: BG11386
UniProt: P49814 A0A6M3ZIA5
Position
complement(2978734..2979672)
AA seq 312 aa
MGNTRKKVSVIGAGFTGATTAFLIAQKELADVVLVDIPQLENPTKGKALDMLEASPVQGF
DAKITGTSNYEDTAGSDIVVITAGIARKPGMSRDDLVSTNEKIMRSVTQEIVKYSPDSII
VVLTNPVDAMTYAVYKESGFPKERVIGQSGVLDTARFRTFVAEELNLSVKDVTGFVLGGH
GDDMVPLVRYSYAGGIPLETLIPKERIDAIVERTRKGGGEIVNLLGNGSAYYAPAASLTE
MVEAILKDQRRVLPTIAYLEGEYGYEGIYLGVPTIVGGNGLEQIIELELTDYERAQLNKS
VESVKNVMKVLS
NT seq 939 nt   +upstreamnt  +downstreamnt
atgggaaatactcgtaaaaaagtttctgttatcggagcaggttttaccggagctacaact
gcatttttaatcgctcaaaaagagctggcagacgttgttcttgttgacattccgcaattg
gagaacccgacaaagggaaaagcgcttgatatgcttgaagcaagcccggttcaaggcttt
gacgcaaaaattacgggaacatccaattacgaggatacagccggctctgacattgttgtc
attacagccggtatcgcaagaaaacctggtatgagcagagatgatctggtctctacaaac
gaaaagattatgagaagcgttacgcaggaaatcgtgaaatattctcctgactctattatt
gtggtgctgacaaatcctgttgatgcaatgacatacgcggtgtacaaagaatcaggcttc
cctaaagagcgtgtaatcggccagtcaggtgtgcttgatacggcaagattcagaacattt
gtggcagaggaattaaacctgtcagtgaaagatgtgactggtttcgtactcggcggacac
ggtgacgatatggttccgcttgtgcgttattcttatgctggcggtatcccgcttgaaact
cttattccgaaagaacggattgacgcaattgtggagcgcactagaaaaggcggaggcgaa
atcgtgaatcttcttggaaacggaagcgcgtattatgcgcctgcggcttctctgacagaa
atggtcgaagcgatcttgaaagatcagcgccgcgtccttcctacaattgcttatcttgaa
ggggaatacggctatgaaggcatctaccttggtgttcctacaattgtaggcggcaacggt
cttgagcaaatcattgaacttgaactgacagactatgaaagagcgcagctgaataaatca
gttgaatctgtcaaaaatgtcatgaaagtattatcctaa

DBGET integrated database retrieval system