KEGG   Bacillus subtilis subsp. subtilis 168: BSU29130
Entry
BSU29130          CDS       T00010                                 

Symbol
icd
Name
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU29130 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU29130 (icd)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BSU29130 (icd)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 938183
NCBI-ProteinID: NP_390791
Pasteur: BG10856
BSORF: BG10856
UniProt: P39126 A0A6M4JLV7
Structure
PDB: 
1HQS

Position
complement(2979716..2980987)
AA seq 423 aa
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEYGDKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt   +upstreamnt  +downstreamnt
gtggcacaaggtgaaaaaattacagtctctaacggagtattaaacgtaccaaacaacccg
attatcccatttatcgaaggagacggaaccggtcctgatatttggaacgcggcttcgaag
gttttggaagcagcagtagaaaaagcatacaaaggcgaaaagaaaattacatggaaagaa
gtttacgccggagaaaaggcttataataaaacaggtgagtggctccctgctgaaacatta
gatgtgatccgcgaatatttcatcgcgattaaaggcccgttaacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctcagacaagagcttgacctattcgtctgcttaaga
cctgtaagatactttactggagtgccgtcaccggtaaaacgccctgaagatactgatatg
gtcatcttccgtgaaaatacagaagatatttacgcaggcatcgagtatgcaaaaggctct
gaagaagtgcaaaagcttatcagcttccttcaaaatgagttaaacgtcaataaaatccgt
ttccctgagacatcaggtatcggcattaagcctgtttcagaagaaggaacaagccgcttg
gtcagagctgccattgattatgcgatcgagcatggccgcaaatctgtaacacttgttcac
aaaggaaacatcatgaagttcacagaaggcgccttcaaaaactggggctatgaacttgct
gaaaaagaatacggagataaagtcttcacatgggctcaatatgaccgcattgctgaagaa
caaggaaaagacgctgccaacaaagcgcaaagcgaagcggaagcagcaggaaaaatcatt
atcaaagacagcattgctgacattttccttcagcagatcttaacgcgtccaaacgagttt
gatgtcgttgcgacaatgaacttgaacggagattacatttctgatgctcttgctgcgcaa
gtcggcggaatcggcattgctcctggagcgaacatcaactacgaaacaggacatgcgatt
ttcgaggcgacgcacggaacggctcctaaatatgcaggccttgataaagtaaacccatct
tcagttattctttcaggcgttctgcttcttgagcatttaggatggaacgaagcggctgat
ttggttatcaaatctatggaaaaaacaatcgcttctaaagtcgtaacttacgattttgcc
agattaatggacggggcgactgaagtgaaatgttcagagttcggagaagaactgatcaaa
aacatggactaa

DBGET integrated database retrieval system