KEGG   Bacillus subtilis subsp. subtilis 168: BSU29150
Entry
BSU29150          CDS       T00010                                 

Symbol
ytwI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF441
Other DBs
NCBI-GeneID: 935947
NCBI-ProteinID: NP_390793
Pasteur: BG13933
BSORF: BG13933
UniProt: O34811 A0A6M4JKP8
Position
complement(2982603..2983067)
AA seq 154 aa
MFTQANLFLILLLAIALIAKNQSLLFAVSVLLIIKIVGLDQKLFPTIQSKGINWGVTIIT
IAVLVPIATGEIGFKQLGEAMRSSYAWIALGAGIAVALIAKNGLTLLENDPHITTALVIG
TILAVALFGGVAVGPLIGAGIAYLAMQIVKLFTS
NT seq 465 nt   +upstreamnt  +downstreamnt
gtgtttacacaagcgaatttatttttaattttactcttggctatcgcacttatcgcaaaa
aaccaatcattgctctttgctgtatccgtccttttgatcatcaaaatcgttgggcttgat
cagaaattatttccgaccatccagtcaaaaggcattaactggggtgtgaccattattacc
atcgccgttcttgtcccgattgccacgggagaaatcggatttaagcagcttggagaagca
atgcggtcttcctacgcatggatcgcccttggagcggggatcgcagtggcgctgattgca
aaaaacggcctgaccctgcttgaaaatgatccgcatattacaactgctctcgtgatcggg
accattcttgcagtcgcgctttttggaggagttgcggtggggccgctgatcggagcgggg
attgcttatttagccatgcagatcgtaaaactgttcacttcataa

DBGET integrated database retrieval system