KEGG   Bacillus subtilis subsp. subtilis 168: BSU29160
Entry
BSU29160          CDS       T00010                                 

Gene name
ytvI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AI-2E_transport
Other DBs
NCBI-GeneID: 937380
NCBI-ProteinID: NP_390794
Pasteur: BG13930
BSORF: BG13930
UniProt: O34991 A0A6M4JNX3
Position
2983164..2984279
AA seq 371 aa
MNQSYITIFFRTLFVISMTAGSIAAAYYSFPLTYPFLIALILSSVIHPVVDYLDKVTGFP
RTINVLGVLAFFLLAAFGVLTILVAEIVTGTAYLAKTLPPHISTFISYCEKLFTTHIQPL
YNELTLLFQELETNQQASIVTHIQTLGDSAAKNAGLLLSHILEMIPRFFALLPNTAAVLI
FSLLATFFMTKDWHKLKAMLVLILPDRVTANSKAISSELKKAMTGFIKAQAVLVFITMVI
VFIGLSLLKVEHAATIAFLIGLVDLLPYLGAGSVFVPWILYLSITGQLPQAIGIGILYLV
VLIQRQLTEPKILSKSIGIDPLATLIALFAGFKLFGFLGLIAGPAVLVIIQAFITTGALK
EIWSYITVQQK
NT seq 1116 nt   +upstreamnt  +downstreamnt
gtgaatcaatcttatatcactatttttttcagaaccctctttgtcatatcaatgaccgca
gggtcgatagctgcggcctattattcgtttccgttaacttatccgttcctgatcgccctt
attctatcttcagtgattcatcctgttgtcgattatttggacaaagtgacaggattcccc
cgaacgataaatgttctgggcgttcttgctttttttctgctcgcagccttcggcgtgctc
accattctggtagccgaaatcgtaacgggaacagcctatctagcaaaaacgctgcctccg
catatcagcacgtttatttcatattgcgaaaaattgtttaccactcatattcagccgctc
tataacgagttaactcttttgtttcaagaattggaaacgaaccagcaggcttccatcgtc
actcatatccagacactcggtgattctgccgctaaaaatgccgggctcctgctgtcccac
attctagagatgatcccgagatttttcgctcttcttcccaatacggcggcggttctgatt
ttttctcttctggcaaccttttttatgacaaaggattggcataagctgaaagccatgctt
gttttaattctgccggatcgtgtgacagctaacagcaaagcaatcagcagcgaattaaaa
aaagcaatgactggttttatcaaagcacaagccgtcctcgttttcatcacgatggtgatt
gtatttatcggcctttctctcttaaaggttgaacacgccgcaacaattgcttttttaatc
gggcttgtagatcttctcccttacttaggtgccggctccgtatttgtgccctggattttg
tatttatcgattacgggccagctgccccaagcaatcggaattggtatcctgtacctcgtc
gttcttattcagcggcagctgacagagcccaagatactaagtaaatctatcgggatcgat
ccgctggcaacactcatcgccctgtttgccggctttaaattattcgggtttttaggactg
attgcgggaccggctgtactcgtcatcatccaagctttcatcacaacaggcgcattaaaa
gaaatatggtcctatatcaccgttcagcaaaaataa

DBGET integrated database retrieval system