KEGG   Bacillus subtilis subsp. subtilis 168: BSU29170
Entry
BSU29170          CDS       T00010                                 

Symbol
fxsA
Name
(RefSeq) hypothetical protein
  KO
K07113  UPF0716 protein FxsA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU29170 (fxsA)
SSDB
Motif
Pfam: FxsA ATP-synt_I
Other DBs
NCBI-GeneID: 937382
NCBI-ProteinID: NP_390795
Pasteur: BG13935
BSORF: BG13935
UniProt: O32064 A0A6M3ZFD4
Position
complement(2984312..2984695)
AA seq 127 aa
MRFLFLLFIVFPAIEIGIFLFLGNLIGILPTVLFMILTGIIGAAAAKKQGTEVYYKVQRD
LQYGKMPGEAIADGLCIFIGGLLLMLPGFLSDLAGACLLIPFTRGWCKPILFKWLRGMSK
NKRIIIK
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagatttttgtttttgctttttattgtgtttccggcaatagaaatcggtatattccta
tttttaggaaatctgattggtattttgccgacagttctattcatgattctgactggcatt
atcggcgcagcagctgcaaaaaaacaaggaaccgaagtgtattataaggttcagcgtgat
cttcaatatggcaaaatgccgggagaagcgattgctgacggtctgtgcattttcattggc
ggtctattgctgatgcttccgggctttttatcagatttggccggcgcctgtcttcttatc
ccgtttacccgcggctggtgtaagccgattctgttcaaatggctgagaggaatgtcgaag
aataagcggatcatcatcaaataa

DBGET integrated database retrieval system