KEGG   Bacillus subtilis subsp. subtilis 168: BSU29180
Entry
BSU29180          CDS       T00010                                 

Symbol
pyk
Name
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU29180 (pyk)
   00620 Pyruvate metabolism
    BSU29180 (pyk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bsu04131]
    BSU29180 (pyk)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU29180 (pyk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BSU29180 (pyk)
Membrane trafficking [BR:bsu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BSU29180 (pyk)
Exosome [BR:bsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BSU29180 (pyk)
SSDB
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI IF2_N DUF2399 PEPcase_2 DRTGG
Other DBs
NCBI-GeneID: 936596
NCBI-ProteinID: NP_390796
Pasteur: BG12661
BSORF: BG12661
UniProt: P80885 A0A6M4JKB7
Position
complement(2984788..2986545)
AA seq 585 aa
MRKTKIVCTIGPASESIEMLTKLMESGMNVARLNFSHGDFEEHGARIKNIREASKKLGKN
VGILLDTKGPEIRTHTMENGGIELETGKELIISMDEVVGTTDKISVTYEGLVHDVEQGST
ILLDDGLIGLEVLDVDAAKREIKTKVLNNGTLKNKKGVNVPGVSVNLPGITEKDARDIVF
GIEQGVDFIAPSFIRRSTDVLEIRELLEEHNAQDIQIIPKIENQEGVDNIDAILEVSDGL
MVARGDLGVEIPAEEVPLVQKELIKKCNALGKPVITATQMLDSMQRNPRPTRAEASDVAN
AIFDGTDAIMLSGETAAGSYPVEAVQTMHNIASRSEEALNYKEILSKRRDQVGMTITDAI
GQSVAHTAINLNAAAIVTPTESGHTARMIAKYRPQAPIVAVTVNDSISRKLALVSGVFAE
SGQNASSTDEMLEDAVQKSLNSGIVKHGDLIVITAGTVGESGTTNLMKVHTVGDIIAKGQ
GIGRKSAYGPVVVAQNAKEAEQKMTDGAVLVTKSTDRDMIASLEKASALITEEGGLTSHA
AVVGLSLGIPVIVGLENATSILTDGQDITVDASRGAVYQGRASVL
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgagaaaaactaaaattgtttgtaccatcggtccggcaagtgaaagtattgaaatgctt
acgaaattaatggagtcaggaatgaacgtggctcgattaaacttttctcacggagatttt
gaggagcacggtgcaagaattaaaaatatccgcgaagcaagtaaaaaacttggcaagaac
gttggaattctgcttgatacaaaaggtcctgaaatccgcacacatacaatggaaaacggc
ggtattgagcttgaaacaggcaaagagctcattatttcaatggacgaggttgtaggaaca
acagataaaatttcagtgacatatgaaggtttagtccatgacgttgaacaaggttcaacg
attctgttagatgacggccttatcggtcttgaggtacttgatgtagatgccgctaaacgc
gaaatcaaaacaaaagtattaaacaacggaacactcaaaaataaaaaaggtgttaacgta
ccgggcgtaagtgtcaatcttccggggattactgaaaaggatgcgcgagacatcgttttc
ggtattgagcaaggagtagacttcatcgcaccatctttcattcgacgttctacggatgtg
ctcgaaatccgtgagcttcttgaagagcacaacgctcaggatattcaaatcatccctaaa
atcgaaaaccaagagggcgttgacaacatcgatgcgattctcgaagtgtctgacggctta
atggttgcacgcggagacttaggtgtggaaattccagctgaagaagtgccgcttgtgcaa
aaagaactgatcaaaaaatgcaacgcgctgggcaaacctgttattacagcgacacaaatg
cttgacagcatgcagcgcaacccgcgtccgactcgtgcggaagcaagtgacgttgcaaac
gcgatcttcgacggaacagatgcgatcatgctttctggtgaaactgctgccggaagttac
ccggttgaagcagttcaaacaatgcataacatcgcgtcccgttctgaagaagcattaaat
tataaagaaattctctcaaaacgcagagaccaagtgggcatgacaattacagacgcaatt
ggacaatctgtcgcacatacggcgattaacctgaatgctgctgcgatcgtaacgccgaca
gaaagcggccatacagcacgtatgattgcaaaataccgtccgcaggctccgattgttgcg
gttactgtaaatgactctatttccagaaagcttgccctcgtatctggcgtattcgcggaa
agcggccaaaatgcgagctcaacagatgagatgcttgaggatgctgtccaaaaatcattg
aacagcggaattgtaaaacacggcgatcttatcgttattacagctggcactgtcggtgag
tccggcactacgaacttaatgaaggttcatactgtcggcgatatcatcgctaaaggccaa
ggcattggacgcaaatcagcttacggtccggttgtcgttgcacaaaatgcaaaagaagct
gagcaaaaaatgactgacggtgcggtacttgttaccaaaagcactgaccgtgatatgatt
gcatcccttgaaaaagcgtctgctcttattacagaagaaggcggtttgactagccatgct
gcggtagtcggattaagccttggcatcccggttatcgtgggtctggaaaatgcgacatct
attttgacagatggccaggatattacagttgacgcttccagaggcgcagtctatcaaggc
cgtgcgagcgttctttaa

DBGET integrated database retrieval system