KEGG   Bacillus subtilis subsp. subtilis 168: BSU29200Help
Entry
BSU29200          CDS       T00010                                 

Gene name
accA
Definition
(RefSeq) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU29200 (accA)
   00640 Propanoate metabolism
    BSU29200 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU29200 (accA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     BSU29200 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BSU29200 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE
Motif
Other DBs
NCBI-GeneID: 936367
NCBI-ProteinID: NP_390798
Pasteur: BG12557
BSORF: BG12557
UniProt: O34847
Position
complement(2987731..2988708)
Genome map
AA seq 325 aa AA seqDB search
MAPRLEFEKPVIELQTKIAELKKFTQDSDMDLSAEIERLEDRLAKLQDDIYKNLKPWDRV
QIARLADRPTTLDYIEHLFTDFFECHGDRAYGDDEAIVGGIAKFHGLPVTVIGHQRGKDT
KENLVRNFGMPHPEGYRKALRLMKQADKFNRPIICFIDTKGAYPGRAAEERGQSEAIAKN
LFEMAGLRVPVICIVIGEGGSGGALGLGVGNHLHMLENSTYSVISPEGAAALLWKDSSLA
KKAAETMKITAPDLKELGIIDHMIKEVKGGAHHDVKLQASYMDETLKQSLKTLLKLSEEE
LVQQRYEKYKAIGKVSVEDQYIGVN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggctccaagattagaatttgaaaaaccggtgattgaactgcaaaccaaaatcgccgaa
ctaaaaaaattcacccaagattccgatatggatctaagtgcggaaatcgaacggctcgaa
gaccgtctcgctaagcttcaggatgatatttacaaaaatttgaagccgtgggaccgggtt
caaatcgcgcgtctggcggaccgtccgacaactcttgattatatcgaacacctgtttacc
gacttttttgaatgtcacggagacagagcgtacggggacgatgaagccattgtcggcggg
attgcgaagttccacggcctccctgtaacggtaatcgggcatcagcgcggcaaagacacg
aaggaaaacctagtccgcaattttgggatgccgcatccagaaggctacagaaaagcgctt
cgtctgatgaaacaggctgacaaatttaacagaccaattatctgttttattgatacgaag
ggggcataccctggacgagcagctgaagaaagaggacaaagtgaagctattgccaaaaac
ctgtttgagatggccggccttcgagtgcctgttatctgcatcgtcattggtgaaggcgga
agcggcggagcccttggtctgggtgtaggcaatcacttgcatatgctggaaaactctact
tattctgttatttctccggaaggtgccgcggcacttttatggaaggactccagtcttgct
aaaaaagcagcagaaacaatgaaaatcactgcgccggatttaaaagaattaggtattata
gatcatatgattaaagaagtaaaaggcggagcgcaccatgatgtgaagctgcaggcaagc
tatatggacgaaacccttaaacaatcgttaaaaactttactgaagctgagcgaagaagaa
ttagttcagcagcgttatgaaaaatataaagcaattggcaaagtctcggttgaagatcaa
tatatcggggtaaactaa

DBGET integrated database retrieval system