KEGG   Bacillus subtilis subsp. subtilis 168: BSU29240
Entry
BSU29240          CDS       T00010                                 

Symbol
ytrI
Name
(RefSeq) sporulation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: OATP LapA_dom
Other DBs
NCBI-GeneID: 937371
NCBI-ProteinID: NP_390802
Pasteur: BG13917
BSORF: BG13917
UniProt: O34460 A0A6M3ZFL2
Position
2995067..2995597
AA seq 176 aa
MADPGASFFMRVPQHYKKPGWQRFFAGMMCGAVISWFFFLFTYGTFQEEQVSLIEKQKEH
VKDLNNQISIYQEDLHKLNEDNKRKLLIQSVSVKLLNGDKYKISQPDKTKFEEHVKDDIS
EVITKDIESVYQTKDLLKRTIENKVYMINEKKYEATVRELIIYTRLTVELEISFAT
NT seq 531 nt   +upstreamnt  +downstreamnt
atggctgacccaggagcatctttcttcatgagggtcccccagcattacaaaaaaccggga
tggcagcgttttttcgcgggaatgatgtgcggagccgtaatcagctggttctttttcctg
tttacttacggaacattccaagaggagcaggtcagcctcatcgaaaagcaaaaagagcat
gtaaaagacttgaacaatcaaatttcgatctatcaggaagacctccataaactgaatgaa
gataataaaagaaaactgctgattcaaagcgtcagcgtcaaattgctgaatggggataaa
tataaaatatcacagccggataaaacgaaattcgaggagcatgtaaaggatgatatttca
gaggtgattacaaaagacatagagagcgtctatcaaacaaaggatctcttgaagcggaca
attgaaaataaagtctatatgatcaatgaaaaaaaatacgaggcaaccgtcagagaattg
attatttatacgaggctgacagtggaacttgaaatttctttcgccacataa

DBGET integrated database retrieval system