KEGG   Bacillus subtilis subsp. subtilis 168: BSU29270
Entry
BSU29270          CDS       T00010                                 

Symbol
ytoI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DRTGG CBS 4HBT GntR HTH_36 HTH_29 HTH_23 HTH_11 HTH_24 PucR TrmB MarR_2 4HBT_3 HTH_28 Rrf2 Hpr_kinase_N HTH_38 Fe_dep_repress MarR HTH_22 4HBT_2 HTH_DeoR HTH_10 Mga TetR_N
Other DBs
NCBI-GeneID: 935941
NCBI-ProteinID: NP_390805
Pasteur: BG13897
BSORF: BG13897
UniProt: O34921 A0A6M3ZEY7
Position
complement(2997301..2998620)
AA seq 439 aa
MATKHEQILTYIDSLPVGEKISVRRIAKEMKVSEGTAYRAIKEAENKGFVSTIERVGTIR
IEQKKKENIEKLTYAEVVNVIDGQVLGGRAGLHKTLNKFVIGAMELDAMMRYTAAGNLLI
VGNRINAHRQALEAGAAVLVTGGFNTDDSIVQLADELELPILSTSYDTFTVAAMINRAIY
DQLIKKEIVLVEDILTPADRTVYLSPKDKLEKWYEKNFETGHGRFPVVDDQMKIHGILTS
KDIAGHDRNASIEKVMTKNPVTVIGKTSVASAAQMMVWEGIEVLPVTDGHQKLIGMISRQ
DVLKALQMIQKQPQVGEKLDDIVSRGFKDEGDDKEDQTVYEYEVTPQMTNQLGTISYGVF
TTILTQAANRFLRSKKRGELVIESITIFFLKPVQMESVIEVKPRILEAGRKFGKMEVEVH
SQGHIVSKAMLMVQLMERS
NT seq 1320 nt   +upstreamnt  +downstreamnt
ttggcaacgaagcatgaacaaattttaacgtatatcgattcactgcctgtcggtgaaaaa
atttctgtccgaagaattgcaaaggaaatgaaagtaagcgaaggaaccgcgtacagagcg
atcaaggaagcagagaataaagggtttgtcagcacgattgaacgtgtgggcacaatcaga
attgaacaaaagaaaaaagagaacattgaaaagcttacctatgcagaggttgtaaatgtt
atagacggacaagtgctcggaggcagggcagggctccataagacattgaataaattcgtc
atcggcgcgatggagcttgacgcgatgatgcgttacaccgcagcggggaatcttttgatt
gtcggaaacagaatcaatgcacacaggcaggcgcttgaagcgggcgcggccgtattggtg
accgggggctttaacacggatgacagcattgtgcagctggcagatgagcttgaactgccg
attttatccacgagctatgacacctttacagttgccgcgatgattaaccgggcaatatat
gaccagctgatcaaaaaagaaattgttttggtggaggacatcctaacacctgctgaccgc
acggtatatctttcgcctaaggataaacttgaaaaatggtatgagaaaaattttgaaacg
gggcacggccgcttcccggttgtcgacgatcaaatgaaaatccatggcattctgacatca
aaagatattgctggccatgaccgaaatgcatctatagaaaaagtcatgaccaaaaatccc
gtcacggttattgggaaaacatctgtcgcttcagctgcgcaaatgatggtatgggaaggg
atcgaagtgcttcccgtcactgacggccaccaaaaactcatcggcatgatcagccgccaa
gacgtattgaaagctcttcaaatgattcaaaagcagccgcaggtcggggagaagcttgat
gatatcgtttcaagggggtttaaagatgagggtgatgataaagaagatcaaacggtttac
gagtatgaagtcacgccgcaaatgacaaatcagcttggaaccatttcttatggcgtattt
acgaccattttgacgcaagcggcaaaccgatttttgcgctcgaaaaaacgcggcgaactc
gtcatagagagcatcaccatcttctttttgaagcctgtgcagatggaatcagtcatcgaa
gtcaaacctcgcatcttggaggccggcagaaagtttgggaaaatggaagtggaagtgcac
agccaaggtcatatcgtgtctaaagcgatgctgatggttcagctgatggaaagaagctaa

DBGET integrated database retrieval system