KEGG   Bacillus subtilis subsp. subtilis 168: BSU29310Help
Entry
BSU29310          CDS       T00010                                 

Gene name
ytnJ
Definition
(RefSeq) monooxygenase MoxC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-GeneID: 937365
NCBI-ProteinID: NP_390809
Pasteur: BG13893
BSORF: BG13893
UniProt: O34974
Structure
PDB: 

Position
complement(3001724..3003052)
Genome map
AA seq 442 aa AA seqDB search
MTRADFIQFGAMIHGVGGTTDGWRHPDVDPSASTNIEFYMKKAQTAEKGLFSFIFIADGL
FISEKSIPHFLNRFEPITILSALASVTKNIGLVGTFSTSFTEPFTISRQLMSLDHISGGR
AGWNLVTSPQEGAARNHSKSNLPEHTERYEIAQEHLDVVRGLWNSWEHDAFIHNKKTGQF
FDQAKLHRLNHKGKYFQVEGPLNIGRSKQGEPVVFQAGSSETGRQFAAKNADAIFTHSNS
LEETKAFYADVKSRAADEGRDPSSVRIFPGISPIVADTEEEAEKKYREFAELIPIENAVT
YLARFFDDYDLSVYPLDEPFPDIGDVGKNAFQSTTDRIKREAKARNLTLREVAQEMAFPR
TLFIGTPERVASLIETWFNAEAADGFIVGSDIPGTLDAFVEKVIPILQERGLYRQDYRGG
TLRENLGLGIPQHQSVLHSSHH
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtgcagattttattcagtttggagccatgattcacggtgtcgggggaacaact
gacggctggcgtcatcccgatgttgatccctcggccagcacgaatattgaattttacatg
aaaaaggcgcaaacagctgaaaaaggtttgtttagttttattttcattgcagacggctta
tttatttctgaaaaatcgattcctcattttttaaaccgttttgaaccgatcaccatttta
tctgcgctggcatcggttaccaaaaatattggtttagtagggacgttctctacatctttt
actgagccattcactatctccagacaattgatgtcgctggaccatatcagcgggggcagg
gccggctggaatctggttacttcgccgcaggaaggagcggcgcgcaaccatagtaagtct
aatttgccagaacacactgaacgttacgagatcgcacaagagcatttggatgttgtgcgc
gggctgtggaattcctgggagcatgacgcatttatacacaataagaaaacagggcagttt
ttcgatcaggcgaagcttcatcgcctgaatcataaaggaaagtattttcaagtagagggg
cccttgaatatcgggcgctctaagcagggagagcctgtagtgtttcaagcgggttcatca
gaaacaggccggcagtttgctgctaaaaatgcggatgcgatttttacccattccaattca
ttagaagagacaaaagcgttttatgcggatgtgaaaagccgagctgctgatgaagggcgt
gatccttcaagtgtgcggatttttccagggatcagcccgattgtggcagatacggaagaa
gaggcggaaaagaagtatcgtgaatttgcagaattgataccgattgaaaatgctgttact
tatttggcccgtttttttgatgattatgatctgagtgtttacccgttggatgagccattt
cccgatattggcgatgtgggaaagaatgcgtttcaaagcacaacagaccggattaagaga
gaagcaaaagccagaaatctgacattgcgggaggtagcacaggaaatggcttttccacgg
actctattcatcggaacaccagagcgtgtcgcatccttaattgaaacttggttcaacgct
gaggcggcggatgggtttatcgttgggtcggatataccgggaacacttgatgcttttgta
gaaaaggtgattccgattcttcaagaaagagggctttatcgtcaagattatcgcggcggg
acattgcgggaaaatctcggtcttggcattccgcagcatcaatccgttttacattcatca
catcattag

DBGET integrated database retrieval system