KEGG   Bacillus subtilis subsp. subtilis 168: BSU29360
Entry
BSU29360          CDS       T00010                                 

Gene name
tcyL
Definition
(RefSeq) L-cystine transport system permease protein TcyL
  KO
K16958  L-cystine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU29360 (tcyL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU29360 (tcyL)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   L-Cystine transporter
    BSU29360 (tcyL)
Motif
Pfam: BPD_transp_1 HupE_UreJ_2
Other DBs
NCBI-GeneID: 936115
NCBI-ProteinID: NP_390814
Pasteur: BG13886
BSORF: BG13886
UniProt: O34315 A0A6M3ZFF6
Position
complement(3005859..3006578)
AA seq 239 aa
MEKAFDMNMIGDFVPTLTAYLPVTLYILTLSLLFGFVLGLFLALPRIYNIPIVNQLAKVY
ISFFRGTPIMVQLFIVFYGIPALTGLIGIDTSKMDPFYAAVATYALSNAAAAAEIIRAGV
GSVDKGQTEAAYSIGLSGSQAFRRIVLPQALVQAFPNMGNMVISSLKDTSLAFSIGVMDM
SGRGQTLITSSNHSLEVYIALSIVYYAVAVLFEWFFRVAEKRIKKNQTRIVTVFDMNIH
NT seq 720 nt   +upstreamnt  +downstreamnt
atggaaaaagcgtttgatatgaacatgattggagattttgtgccgacgttaaccgcttat
ttaccggttacattatacattttaacactgtccttgcttttcggttttgtattaggactc
tttctggcactgccccgcatctataatattccaattgtaaatcaattggcaaaagtgtat
atctcgtttttcaggggaacgcctatcatggtgcagcttttcatcgtgttttacgggatc
ccggcgcttacggggcttatcgggattgatacatcaaaaatggacccgttttatgctgct
gtcgcaacctacgcgttaagcaatgcagcggcagccgcagaaatcattcgagcgggggtg
ggcagtgtagataaaggccaaacggaagcggcgtacagtattggcttaagcggtagtcag
gccttcaggcgaatcgttctgccccaggcacttgtccaggcgtttccgaatatgggaaac
atggtgatcagttctttaaaagatacgtctctagccttttcaataggtgttatggatatg
tccggaaggggccaaacactgattacctcaagcaaccattctcttgaagtttacattgcg
ctatcgattgtttattatgctgtagcggttttattcgaatggttctttcgagtggcagaa
aaacgaatcaagaagaatcaaacaaggattgttactgtttttgacatgaacatacattga

DBGET integrated database retrieval system